(data stored in ACNUC7421 zone)

EMBL: CP000821.PE550

CP000821.PE550       Location/Qualifiers
FT   CDS_pept        671696..672217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0551"
FT                   /product="MSHA pilin protein MshA"
FT                   /note="KEGG: saz:Sama_0461 MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35163"
FT                   /db_xref="GOA:A8FQP0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP0"
FT                   /protein_id="ABV35163.1"
FT                   /translation="MKKQNGFTLIELVVVIIILGILAVTAAPKFINLQSDARVSALEGM
FT                   KASLQGANSLVYSKAAIAGDEKKAKGDWTGDNGVDIGTEDKAKTQYGYLQGLQVELENA
FT                   VDVKFNVGTSATDPKIKTDNKADWVIFVKSGVATIWQTDAPAACKFTYTESDGVGKTPS
FT                   FSDMPTASGC"
     gtgaaaaaac aaaatggttt tacactaatc gaattagtgg tcgttatcat catcttaggt        60
     atcttagccg tcacggcagc acctaaattt atcaacctgc agagcgatgc acgagtttca       120
     gctttagaag gtatgaaggc ttctcttcaa ggtgcaaact ctctggttta ctcaaaagcg       180
     gcaatagccg gagatgagaa aaaagctaaa ggcgattgga ctggtgataa tggagttgat       240
     attggaactg aagacaaggc taaaactcag tatggttacc tacagggctt acaggttgag       300
     ttagagaatg ctgttgatgt gaagtttaat gttggtactt cagctactga cccaaaaata       360
     aagactgaca acaaggctga ctgggttatt tttgtaaagt ctggtgtagc tacaatttgg       420
     caaacagatg cacctgcagc gtgtaagttt acttacaccg aatctgatgg tgtaggtaaa       480
     acaccatcgt tttcagatat gccaacggct tcaggctgtt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page