(data stored in ACNUC7421 zone)

EMBL: CP000821.PE551

CP000821.PE551       Location/Qualifiers
FT   CDS_pept        672263..672742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0552"
FT                   /product="MSHA pilin protein MshA"
FT                   /note="KEGG: saz:Sama_0461 MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35164"
FT                   /db_xref="GOA:A8FQP1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP1"
FT                   /protein_id="ABV35164.1"
FT                   /translation="MNKQSGFTLIELVVVIIILGILAVTAAPKFINLQSDARVSTLQGM
FT                   KAAIQGANSLYYSKAAIGSHEKKDSVTVEGVLVSYGYLQATKANMVLALEIAESDWTID
FT                   DTTDRVAGVPPAKSTPGVITISQTDAPSTCTFTYTEADSASDTPSFSVMPDADKC"
     atgaataagc aaagcggttt tacactaatc gaattagtgg ttgttattat catactaggt        60
     attttggctg taacggctgc acctaagttc attaaccttc aaagtgatgc tcgtgtatct       120
     acgcttcagg gaatgaaagc ggccatccaa ggggctaact cactctatta ttcgaaagcg       180
     gcaataggct ctcatgagaa gaaagactca gtaacagttg aaggtgtgct tgtttcttat       240
     ggctatcttc aggctactaa agcgaatatg gttttggcgc ttgagattgc agagagtgat       300
     tggaccattg acgatactac tgaccgagtg gcaggcgttc cgccagcaaa gtctacacct       360
     ggtgtaatca ccatttcgca gaccgatgcg ccttctacct gtacatttac ctatacagag       420
     gcagattcag cttcagacac tccaagcttc tcggtaatgc ctgacgcgga taagtgctaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page