(data stored in ACNUC7421 zone)

EMBL: CP000821.PE552

CP000821.PE552       Location/Qualifiers
FT   CDS_pept        672951..673418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0553"
FT                   /product="MSHA pilin protein MshC"
FT                   /note="KEGG: shw:Sputw3181_3603 MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35165"
FT                   /db_xref="GOA:A8FQP2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP2"
FT                   /protein_id="ABV35165.1"
FT                   /translation="MRTVLPQSGFTLVELVTTIILIAILSVVVLPRLMTSSSYSAFTLR
FT                   DEFVSELRKAQLLAMNNGDYCYRIAVDTTGYQLQGFDNTGCTGTAKLTETKQTFEGRAS
FT                   LELDSDSSKSFKVNFDRQGIASLGCSGACIKVIADETLTISIESQGYIHGR"
     atgcgaacag tcttgccaca aagcggcttt accttggtag agctggttac caccatcatc        60
     ttgattgcca ttctctctgt ggtggtgtta ccgcgcctga tgacaagctc cagctacagt       120
     gcattcaccc tgcgagacga atttgtctct gagcttcgca aggctcagtt gttggcgatg       180
     aataatggag actattgcta tcgtatcgcc gtagatacta cgggatatca actgcaggga       240
     tttgataaca ctggctgtac aggtaccgct aagttgaccg agactaagca gacatttgaa       300
     gggcgcgcca gcctggaatt agatagtgac agttcaaaaa gcttcaaggt taatttcgac       360
     agacagggga tcgctagctt aggctgtagc ggggcctgta tcaaggtgat tgccgatgag       420
     accttaacca tcagtattga gagtcagggg tatattcatg gccgttaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page