(data stored in ACNUC7421 zone)

EMBL: CP000821.PE553

CP000821.PE553       Location/Qualifiers
FT   CDS_pept        673408..674004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0554"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0399 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35166"
FT                   /db_xref="GOA:A8FQP3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP3"
FT                   /protein_id="ABV35166.1"
FT                   /translation="MAVNSLSITKRTGALVITKGFTLVELVVGMVVLSIALVMLTSMLF
FT                   PQADRAAETLHRVRSAELAHSVMNEIWGKRYDQNTNPNGGVPACGAAARPDLGLPAGLA
FT                   CTAPGALGPDTGENRNSYNDVDDYHGLNQNSLMLNAAVTTGVNADTYASRYPNYLLAVA
FT                   VTYPDTSDLNRKLITVTVTTPSGEQIVYNAVRSNY"
     atggccgtta actcactctc gataacaaag cgaacaggtg ctcttgtgat aacaaagggc        60
     tttaccttag tcgagctcgt ggtcggcatg gttgtgctga gcatcgcctt ggtcatgctg       120
     accagcatgc tgttccccca ggccgaccgc gcggccgaga ccctgcacag ggtgcgctcc       180
     gccgagctgg cccattcggt gatgaatgag atctggggta aacgctacga tcaaaacacc       240
     aaccccaatg gtggtgtccc cgcatgtggc gccgcagcga gacccgatct gggtcttcct       300
     gcaggcttgg cttgtaccgc gccgggagcg cttggcccgg ataccggtga gaaccgtaac       360
     agctataatg atgtcgatga ttaccatgga ctcaatcaga acagcttgat gttgaatgcc       420
     gcagtaacaa caggagttaa tgctgacacc tacgccagtc gctacccgaa ttacctgctg       480
     gcggttgcgg tgacctatcc cgatacctca gatctgaacc gtaaactgat aacggttact       540
     gtgacgacgc caagtggcga gcagatcgtc tacaatgcgg tcaggagtaa ctactga          597
//

If you have problems or comments...

PBIL Back to PBIL home page