(data stored in ACNUC7421 zone)

EMBL: CP000821.PE554

CP000821.PE554       Location/Qualifiers
FT   CDS_pept        674004..674813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0555"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0400 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35167"
FT                   /db_xref="GOA:A8FQP4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP4"
FT                   /protein_id="ABV35167.1"
FT                   /translation="MSGLRQLRKSDGFTLVEMVMVIIILGILVLGVSSFVIIGTRIFVE
FT                   STSVDQVLSQSRFAIERMTREIRNAVPNSLRVTNTATYQCMEFMPIQGSASYIDLPIAP
FT                   EAASETGSIITPSQGINNTHRMLVYPLTPAHIYEADPTSSEGRLLDIEKVEGNTVTFDR
FT                   AVRISEASPRNRYFMVNNAVSYCFFTNGDVRRYEGYSMFNTAQPAPADMGDGVLMAEGV
FT                   VTGTGTWPINYTPGSLTNNAVVQLTPTFMVNGQEFQYQHQVQVVNVP"
     atgtcgggct taagacagct acgcaagagc gacggtttta ctctggttga gatggtaatg        60
     gtgatcatca tcttaggcat cttggtgctg ggggtcagta gcttcgtgat cataggcacc       120
     cgcatcttcg tcgaatcaac ctcggtggat caggtgctca gtcagagtcg tttcgccatc       180
     gaacgtatga cccgcgaaat tcgaaacgcc gtaccaaaca gtttgcgtgt taccaataca       240
     gcaacatatc aatgtatgga gtttatgcca attcagggca gtgcctccta tatcgatctg       300
     cctatcgccc cagaggcggc aagcgagacc ggtagcataa tcacgccatc acagggcatc       360
     aacaatacac accgaatgtt ggtctaccct ctgacaccgg ctcatatcta cgaggctgac       420
     cctacttcat cagaaggacg tctattggat atagagaagg ttgaaggtaa tactgttact       480
     ttcgatcggg cagtgcgtat cagcgaggcg tctccgagaa accgttattt tatggtaaac       540
     aacgcggtga gttactgctt ctttaccaat ggtgatgtca ggcgctatga aggctatagc       600
     atgtttaata cggcgcaacc cgctcctgcg gatatgggag atggggtgtt gatggctgag       660
     ggtgtggtta ccggcacagg cacatggcca atcaactata ctcccggcag cttaaccaat       720
     aacgccgtcg tacagttaac gccgacattt atggtcaatg gtcaggagtt tcaatatcag       780
     caccaggtgc aggtggtcaa tgtcccctaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page