(data stored in ACNUC7421 zone)

EMBL: CP000821.PE555

CP000821.PE555       Location/Qualifiers
FT   CDS_pept        674803..675288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0556"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /note="KEGG: sfr:Sfri_3740 MSHA biogenesis protein MshP"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35168"
FT                   /db_xref="GOA:A8FQP5"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP5"
FT                   /protein_id="ABV35168.1"
FT                   /translation="MSPNMSHRANRPFRGFSHCRAKQQGSALVIGIFVITVMFLMSAAL
FT                   INVLEDADEQVSLEVWGTRALFAANSGADRALAQLFPLTATDASAASCTNVKEWKNLPS
FT                   VPGFHGCSVVLTCVTNTVDSVNSYRITSTATCETGNCSGNDSSCLRVNRQVEVEARD"
     atgtccccta atatgagtca cagagctaac aggccatttc gaggattctc tcactgccgg        60
     gcgaagcagc agggtagtgc gctggtcata ggtatcttcg tcatcacggt gatgttcctg       120
     atgtcggctg cgctaattaa tgtacttgaa gatgccgatg agcaagttag tctcgaggtg       180
     tggggcaccc gcgccctctt tgccgccaac tccggcgccg atcgtgctct cgctcaactg       240
     ttcccgctaa cggcgaccga cgctagcgca gcatcttgta ccaatgtgaa ggagtggaag       300
     aacctaccga gcgtgccggg cttccatggc tgcagcgtcg tcttgacctg tgtgactaat       360
     actgtagata gcgtaaacag ttaccggatc accagcacgg cgacctgcga gacgggaaac       420
     tgtagtggta atgacagcag ttgcctgcga gtcaatcgcc aggtggaggt agaagcccgt       480
     gattag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page