(data stored in ACNUC7421 zone)

EMBL: CP000821.PE556

CP000821.PE556       Location/Qualifiers
FT   CDS_pept        675290..678010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0557"
FT                   /product="MSHA biogenesis protein MshQ"
FT                   /note="KEGG: slo:Shew_0402 MSHA biogenesis protein MshQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35169"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP6"
FT                   /protein_id="ABV35169.1"
FT                   /translation="MFKIVLSLALLFPALAIAVPYCSDIFTDPPTGDHGENGLTPPANI
FT                   GPPLGDLNCTRKRGCDNSTSGYFLPGDYSFSEGNFHGGGPSLVNHITTNGTTARLYFDR
FT                   VSLSGVSLNTYGKAEDLIIYVREDLTIAGHNHINGIIYVVGNVSLTGNGSVTGGLAAGG
FT                   SAGVGGNGDFVFDEEAIDNADFGGMCIPGPKPDLNHYRLEFSSGALSCKAKDILIRACA
FT                   DEYCATETSVLSSVDLTKNGGVYSTVNFAGHTVPAAELWHADGGTVLVGLGATAPSAPY
FT                   RCFIDGLEVANIADCQLTFEDTGFYFDAPDTISYKDSGQFELFAATKDPVTQKCESLFK
FT                   NQTKSVDFSFNYKDPNPVNNPASLMLTAPTQSKVIAGGDTESVSVKFDAEGKALLTVNY
FT                   PEAGEVTLKASHTHTVNTPNGSEELVLEHQDSFVAKPAGFHFFNESANNRCASSDPYDA
FT                   DCKVLAKAGESFDMRLKAAGWTSDEDSDFSDNPVLQNFKHSNIQIQAAVEAPSLADGGT
FT                   NGSFSTSAVDFNLSGSESSQLISQSWTEVGTLTAKLTQDISYLGVTISKDNASSELFGR
FT                   FTPAYLDISGNSPSLTHSCGSFTYIDQPFGFSGGGEPIIQVRGMASDDSEARNYQLGDW
FT                   WRYKHKEEASRNQWLGRGYEDKTGELQVQDSEYPGLSGSVSYANNANTATLTGAKVEYV
FT                   RLPTPMVPFDAKFDLKLAVTDLTDEDGICYQADSSGSCQPFSFEDIADGASFELRYGRL
FT                   QLDNGYSPQSESLRLPLRTEYVSAVDAANVPTWVTNGDDSCSVYNTVTSTDTTEAVTTG
FT                   MNMTLPAGFPAITAHSNDELTSQSGTALQGVNHIYFTAPNTPGEVRLKQHVEPWLKWYW
FT                   NYDGNKPNALYDPRASAFFGTYRGHDKVIYWHEVN"
     atgtttaaaa tagtgctcag tctcgcgttg ctgttcccgg ccttggcgat agccgttccc        60
     tattgtagtg atatctttac cgacccaccg acaggggatc atggtgaaaa tggcttaaca       120
     ccgccagcca atatcggtcc tcctcttggg gatctaaact gtactagaaa gaggggctgt       180
     gacaacagca catctggcta ttttttaccc ggagactaca gctttagtga aggaaatttt       240
     catggaggcg gtccttctct cgtcaatcac attaccacta acggcaccac cgctaggctc       300
     tattttgatc gggtgtcttt gagtggtgtt agcttaaata cctatggtaa agccgaagat       360
     ttaattatct atgtacgtga agatcttacg attgccggcc acaaccacat taatggcatt       420
     atctatgtgg ttggaaatgt ttcgctaacc ggaaacggct ctgtaacggg cggcttagcg       480
     gctggtggca gtgccggagt gggtggtaac ggtgatttcg tcttcgatga agaggctatc       540
     gacaatgccg actttggtgg tatgtgtatc cctgggccta agccagactt aaaccattac       600
     cgtcttgagt tttcgtctgg ggcattgagc tgtaaggcaa aagatatcct tattcgtgct       660
     tgtgctgatg aatattgtgc tacggaaaca tcagttttat cgagtgtcga tttgaccaaa       720
     aacggtggcg tatacagtac ggttaacttc gcagggcata cagttccggc tgcagagctc       780
     tggcatgcgg acgggggaac agttttagtt ggtcttggag ctaccgctcc gtcagctcct       840
     tatcgctgct tcatcgatgg ccttgaagtc gccaatattg ccgactgtca attaaccttt       900
     gaagacactg gtttctattt tgatgcaccg gatacgatat cttataaaga tagcggtcag       960
     tttgaactgt ttgctgccac caaagaccct gttactcaga agtgtgagtc tctctttaag      1020
     aatcaaacca agtctgtaga tttttcgttt aactataaag acccaaaccc ggtgaataac      1080
     cccgcatcat taatgctgac ggcgcccact cagagtaaag taattgcagg tggtgatacc      1140
     gagagtgtga gtgtgaaatt tgacgcagaa ggaaaagcac tgttaacggt gaactaccct      1200
     gaagccggcg aggtgacact caaggcatcc catacccata cggtgaatac accaaatggc      1260
     tcagaggagt tagtgctcga gcatcaagat agcttcgtcg ctaaaccggc aggcttccac      1320
     tttttcaatg aatcagctaa caatcgatgc gccagctccg atccctatga tgcagactgc      1380
     aaagtactag ctaaggctgg agaaagtttc gatatgcgcc tgaaagccgc aggctggacc      1440
     tcagacgaag acagcgattt cagcgataac cctgttctgc aaaattttaa gcatagtaat      1500
     attcagatac aggcagcggt agaggcacca tcgctagccg atggaggcac caatggcagc      1560
     tttagcactt ctgcggtaga tttcaattta tcgggtagtg agagttcaca acttatcagt      1620
     caaagttgga ctgaagtggg gactctcacg gcaaaactca ctcaagatat cagctatctg      1680
     ggggtcacca tctcaaaaga taatgccagc agtgaactgt ttggccgttt cactccggct      1740
     tatctggata tatccggaaa ctctccctca ctgactcata gctgcggcag ctttacctat      1800
     atagatcaac cctttggttt ttcaggaggc ggagaaccaa tcattcaggt aagaggcatg      1860
     gccagtgatg atagtgaagc aagaaactat cagcttggtg actggtggcg atacaagcat      1920
     aaagaggagg caagcagaaa tcagtggctt ggaagaggtt atgaagataa aaccggtgag      1980
     ctacaagttc aagatagtga atatccgggt ttatcgggca gtgtgagcta cgccaataac      2040
     gctaatacag ctacattaac aggtgctaaa gtcgagtatg tgcgtttgcc taccccaatg      2100
     gtaccgttcg atgctaaatt tgatcttaag ttagcagtaa cagatctcac cgatgaggat      2160
     ggtatctgct atcaagccga ctcgtccggt agctgccagc ctttctcttt cgaagatatt      2220
     gccgatggcg cctcatttga gctaaggtac ggccgtttgc agttggacaa cggttatagc      2280
     cctcagtcgg aaagcctgcg tctgcctttg cgaaccgagt atgtcagcgc ggttgatgcg      2340
     gctaatgtcc cgacctgggt aaccaacggt gatgatagct gctctgtgta taacacggta      2400
     acctcgacgg ataccacaga ggcagtgaca acagggatga atatgacctt gccagcaggt      2460
     ttcccggcga taacggctca cagtaatgac gaattaactt cgcaaagcgg aactgcctta      2520
     caaggtgtta atcatatcta ttttaccgct ccgaatacgc ctggggaagt tcggctcaag      2580
     caacatgtcg agccttggct caagtggtat tggaattatg atggcaacaa acctaacgct      2640
     ctctatgatc cgcgagcttc ggccttcttc ggtacctatc gcggccacga caaggtgatc      2700
     tactggcatg aagtcaatta g                                                2721
//

If you have problems or comments...

PBIL Back to PBIL home page