(data stored in ACNUC7421 zone)

EMBL: CP000821.PE557

CP000821.PE557       Location/Qualifiers
FT   CDS_pept        678219..679268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0558"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: slo:Shew_0403 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35170"
FT                   /db_xref="GOA:A8FQP7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP7"
FT                   /protein_id="ABV35170.1"
FT                   /translation="MFKKLRGIFSNDLSIDLGTANTLIYVREEGIVLNEPSVVAIRGER
FT                   GSGGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSV
FT                   FRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHT
FT                   IGTAYPGDEVLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPP
FT                   ELASDISERGMVLTGGGALIRDLDRLLMQETGIPVMVADDPLTCVARGGGKALEMIDMH
FT                   GGDLFSEES"
     atgttcaaga agctgcgtgg cattttttct aacgatcttt cgatcgattt gggtacggct        60
     aacaccttaa tttacgttcg cgaagagggg atcgtactta acgaaccttc tgttgtcgca       120
     attcgtggcg aacgaggtag tggcggacag aagtccgtgg cggctgtagg tacagaagct       180
     aagcagatgt tgggtcgtac tccgggcaat atccaggcta tccgtccgat gaaagacggt       240
     gttatcgccg acttctacgt gacagagaag atgctgcagc actttattaa gcaagtgcac       300
     aacaacagcg tgttccgtcc aagccccaga gtactggttt gtgtgcctgt aggtgcaact       360
     caggtcgagc gtcgtgcaat tcgtgaatct gcaatgggcg ccggcgctcg tgaggtttac       420
     ctgattgaag agccaatggc tgctgcgatc ggtgcgggtc tgcctgtatc tgaggcgaca       480
     ggttctatgg ttgtcgacat cggtggtggt actaccgaag tggcaattat ctcacttaac       540
     ggtgtggtgt attcatcttc tgttcgtatc ggtggtgata agttcgatga tgcgatcatc       600
     aactatgtcc gccgtaacta cggcagcctg atcggtgaag cgactgccga gcgtatcaag       660
     cacactattg gtaccgctta tccgggtgac gaagtgcttg aaattgaagt gcgcggccgt       720
     aacttagccg aaggtgtccc tcgtagcttt acactcaaca gcaacgagat cctcgaagcg       780
     ctgcaagagc cgttatcggg tattgtcagt gccgttatgg tcgcactcga gcaatctcca       840
     ccggagctgg cgtcagatat ctctgagcgc ggtatggtat taaccggtgg tggcgcatta       900
     attcgcgatc tggaccgtct gttgatgcaa gagacgggca ttcctgtgat ggttgccgat       960
     gacccattaa cttgtgttgc tcgaggcggc ggtaaggcgc tggagatgat cgacatgcat      1020
     ggtggtgacc tcttctccga agaaagctaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page