(data stored in ACNUC7421 zone)

EMBL: CP000821.PE558

CP000821.PE558       Location/Qualifiers
FT   CDS_pept        679407..680303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0559"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="KEGG: slo:Shew_0404 rod shape-determining protein
FT                   MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35171"
FT                   /db_xref="GOA:A8FQP8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP8"
FT                   /protein_id="ABV35171.1"
FT                   /translation="MKPIFARGISNQFRLTLAIILSVILIVANNRLDPVRKSVSSVLSP
FT                   LQYVANVPGALLDWSAESLATRNMLTKQNKELLRQQLLMSERLQRFEHLRQENDRLRAL
FT                   LGSPVHMDSKKVVAEVMEVASDPYHQYVVLNHGAMSGVFVGQPVVDAQGVVGQVVQVNE
FT                   LTSRVLLISDATHGIPVRVTRNDVRLVVKGTGVLDELELSYVSKSTDIRVGDLLVSSGL
FT                   GNRFPEGYPVARVMSVVKDDGQSYANVIAQPLAALDRIRYLLLIWPDEQDESLSKDELL
FT                   NIENTSESTKQTAEVSQ"
     atgaagccca tttttgcacg tggtatttca aaccaattca ggctgacact agcaattatt        60
     ttgtcggtga tcctcatcgt ggctaacaac cgactcgacc ccgttcgtaa atctgtctca       120
     tctgttctaa gtcctcttca atacgttgct aatgttcccg gtgcactctt agactggtcg       180
     gccgagagtc tcgcgactcg aaatatgctg acaaagcaga acaaggagct attgaggcag       240
     caacttctga tgagcgagcg actacagcgc ttcgaacacc tcaggcagga aaatgaccgg       300
     ttacgtgcac tactgggctc tcccgtgcat atggactcga agaaggtcgt tgccgaggtg       360
     atggaagttg ccagcgatcc ctatcatcaa tatgtggtac taaatcatgg tgccatgagc       420
     ggcgtgtttg tcggccagcc tgtggtcgat gcccaaggcg tagtagggca ggtggtgcag       480
     gtcaatgagc taaccagcag ggtacttctg atctccgatg caacccatgg tatcccggta       540
     agagtcacgc gtaacgacgt gcgtctggtc gttaaaggca cgggagtgct cgatgaactc       600
     gagctcagtt atgtgtctaa gagtacagat atcagggtcg gcgatctctt ggtctcctcg       660
     ggtttgggaa accgttttcc cgaaggttat cccgttgccc gtgtgatgag cgtggtcaaa       720
     gatgacgggc aaagctatgc caatgtgatc gcccagccgt tagccgcgct cgatagaatt       780
     cgttaccttt tgctgatctg gcccgatgag caggatgaaa gtttgagtaa agatgagctt       840
     ttgaacattg aaaatacctc agaatctaca aagcaaaccg ctgaggtgag ccaatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page