(data stored in ACNUC7421 zone)

EMBL: CP000821.PE559

CP000821.PE559       Location/Qualifiers
FT   CDS_pept        680300..680788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0560"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: slo:Shew_0405 rod shape-determining protein
FT                   MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35172"
FT                   /db_xref="GOA:A8FQP9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP9"
FT                   /protein_id="ABV35172.1"
FT                   /translation="MSMHIANGRWVVWLSFLVAMLFQIMPLPDLVEPWRPDWLLLVIIY
FT                   WAMALPHRYNILSAWVLGVLLDIMLGAHLGIRALSISLVVYVVVLHFQRLRNFPMWQQA
FT                   LMISSLICLYHLVIFWVQFVVDTATFDVRLFLPAISSLIIWPWVFWILRRVRRLYKVR"
     atgagtatgc atattgctaa tggacgctgg gtggtatggt tgagtttcct ggtcgccatg        60
     ttatttcaga taatgcctct gccggatctt gtcgagccgt ggcgcccgga ctggttactg       120
     ctggttatca tctattgggc catggcgttg ccccaccgat ataatatttt atcggcctgg       180
     gtcttaggcg tgctgctcga catcatgctt ggggcacatc tgggtattcg agcgttatcg       240
     atctctctgg tcgtctatgt ggtggtgctg cattttcagc ggttacgtaa cttccccatg       300
     tggcagcagg cactgatgat ctccagtttg atatgcttat atcacctggt catcttctgg       360
     gttcaatttg tcgttgatac ggccacattt gatgtgcgcc tatttttacc cgccatctcc       420
     agcctcatta tctggccttg ggtattttgg atcttacgtc gtgtcaggcg tttatataag       480
     gtgagataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page