(data stored in ACNUC7421 zone)

EMBL: CP000821.PE56

CP000821.PE56        Location/Qualifiers
FT   CDS_pept        complement(66518..67894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0056"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="KEGG: shw:Sputw3181_0485 flagellar hook-associated 2
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34669"
FT                   /db_xref="GOA:A8FP96"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP96"
FT                   /protein_id="ABV34669.1"
FT                   /translation="MISGMSGSQFAEQLIGAERMGKDQLYQSNMTKHQTQLDAYEILEK
FT                   SLNQMTKNLEKLDGDAFDSKTSTVSDDNASITVESGAATGSYDLYVKQLAQAHQISKSF
FT                   SGEDAALPTSGVLTIQVGPDVADTLTLDMAVYNPGGNATVSDLTGMINSHPDNPGVQAS
FT                   LVRTGGQVELMLSSTETGADSTIDVKMDGADWGMTERRAAQDAELTLNGIDIKSSSNYL
FT                   NNVIDGVSIELNKAHGVGESSTIKIESDTDASEQAVKDFVDSFNELMDQINQLTRSMGS
FT                   SVLDDINDDNDKDKDEDDDDDDDDSPSSVTEDQLGALKGDSSVRMLQNSMRSAIFDPAS
FT                   NGMRLSDIGIEMTREGKLEIDEDKLAKALKDDPGAIEAMFTGSDNYVDRMDGIIDPFTK
FT                   SNGYLDLKQENLDKQITRVEDNMARHDYQMEQRYQIYLAQFTAMEATINQLNSASALFY
FT                   "
     atgatttcag gtatgagtgg atcccagttt gcagaacaac tcatcggcgc tgagcgaatg        60
     ggtaaagatc agctgtatca gagcaatatg actaagcatc agacccagct tgatgcctat       120
     gaaatactcg aaaaaagcct gaatcagatg accaaaaatc tggaaaaact agatggcgat       180
     gccttcgaca gcaagacctc gaccgtaagc gacgataacg catcgatcac cgtcgaaagt       240
     ggtgccgcaa cgggtagcta tgacctctat gtcaaacagc tggctcaggc ccatcagata       300
     tccaagagtt tcagtggtga agatgctgct ctccccacaa gtggtgtgct cactatccag       360
     gttgggccgg atgtagcaga caccttaacc ctggatatgg cggtatataa cccaggcggt       420
     aacgccacgg tctccgatct caccgggatg atcaacagcc acccggataa tccgggagta       480
     caagcttcat tggtgcgcac cggcggtcag gttgaactca tgctctcctc tacagaaacc       540
     ggcgccgaca gcactatcga cgtgaagatg gatggtgctg actggggcat gaccgagcgc       600
     agagcggcac aggacgccga gcttaccctc aacggtatcg atataaaaag cagcagtaac       660
     tacctgaata acgtcatcga tggagtgtct attgagctta ataaggccca cggcgtgggc       720
     gaaagcagca ccataaaaat agagtcagat accgatgcca gtgaacaggc ggttaaagat       780
     tttgtggaca gtttcaacga gctgatggat cagataaacc aactgacacg ttccatggga       840
     agttcggtgc tggatgacat caatgacgac aatgataaag acaaggatga agacgatgat       900
     gatgacgacg atgacagccc ctcttcggtc acagaagatc agctcggcgc attaaagggc       960
     gattcgagtg tccgcatgct gcaaaacagc atgagaagcg ccatcttcga tccagcatca      1020
     aacgggatgc gtctatcgga tatcggcatt gagatgactc gagagggtaa attagagata      1080
     gatgaagaca agctagccaa ggccctgaaa gatgatcccg gtgcgataga ggccatgttc      1140
     accggcagcg ataattatgt cgacagaatg gacggcatca tcgatccctt cactaaatcc      1200
     aacggctatt tagatcttaa acaagagaat ctggataagc agatcacccg agtcgaagac      1260
     aacatggctc gccacgatta ccagatggag cagaggtatc aaatctacct cgcccaattt      1320
     acagcaatgg aggccaccat caaccaactt aactcggcca gcgcattgtt ttactaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page