(data stored in ACNUC7421 zone)

EMBL: CP000821.PE560

CP000821.PE560       Location/Qualifiers
FT   CDS_pept        680791..681387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0561"
FT                   /product="maf protein"
FT                   /note="KEGG: slo:Shew_0406 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35173"
FT                   /db_xref="GOA:A8FQQ0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ0"
FT                   /protein_id="ABV35173.1"
FT                   /translation="MNGSARLVLASASPRRKELLTQLGFSKAGFSFDTLSADIDETHQT
FT                   GESPQVFVSRLAVEKAEAGLALCDNLTTPVVLGSDTIVVLGEQILGKPVDEADALKMLT
FT                   DLSGHIHSVMTAVALTDGKKTLTRLVETKVQFCDLNEQDILAYITTGEPMDKAGAYGIQ
FT                   ALGGSFVERIEGSYSAVVGLPLVETRELLKEMKII"
     atgaatggtt cagctcgatt agtattggca tcagcctctc cgcgccgcaa agagttgctg        60
     acgcagcttg gtttttcaaa ggccggattt agctttgata ccctgtctgc agatatcgat       120
     gaaactcatc agacgggtga atcgccacaa gtgtttgttt ctcgccttgc ggtagagaaa       180
     gccgaggctg gattagccct gtgtgataac ctgacaactc ccgtggtatt aggttctgat       240
     actatagttg tattaggtga acagatactg ggtaagccgg tcgatgaagc cgatgcgctg       300
     aagatgttaa ccgatctgtc gggacatatt cacagcgtga tgacggcggt ggctctgacc       360
     gatggcaaga agacactgac gcgtctggtt gagaccaaag tacagttttg tgatctcaat       420
     gagcaagata tcctggccta tatcaccacc ggtgagccta tggataaggc gggagcctac       480
     gggatccagg cattaggcgg aagctttgtt gagcgtatcg agggcagtta ttctgccgta       540
     gtgggcttgc ctctggtaga gacccgtgaa ctgctcaaag agatgaaaat tatttag          597
//

If you have problems or comments...

PBIL Back to PBIL home page