(data stored in ACNUC7421 zone)

EMBL: CP000821.PE562

CP000821.PE562       Location/Qualifiers
FT   CDS_pept        682999..687258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35175"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ2"
FT                   /protein_id="ABV35175.1"
FT                   /translation="MPRQFCPFKFSRFCWQILAIILVLFALAVSLFRGLLPQLAEVRQE
FT                   LVKYVEEQYQVQVNVGELNAEWQAFGPALTVKNLVLPPQERLPFTLIIRDVHVKLDFWE
FT                   SLMTTSPQIENVIFEGVQVGLDLDKLNQAGPSTVSAETDTDWLYRLLLEQLEHFSITEA
FT                   SLQLLSKSHDFRPIYVKDLRWQNRNNKHQGQGKLYLDEKASEVEQLSLSLEIDGNGFRP
FT                   DTLKGQVYLAASSLDLGEWASRQANPYDEKSKLPLEGVVNLQAWLSLGNRSIESGLIQF
FT                   EPSWLEWQLNEEVQHFEIKGGQFEWLPIDKGWQLSSRSLEFETNDRPWSELNFVAQQRG
FT                   EQLSAYLNRLDTSTLLPLLPLAPKVDLLALKTWQSINPQGYLDNIKFSLNGDLGPQVSL
FT                   DINQLQWRNFESIPGSKALDLQVAWYDDSLYFNAPEQAYTLDFSTAFKAPIVLNGAAFD
FT                   ARFNTQYSELTLPRLQFSNKDIGIDASVKMGFAGDTHLALLADVKINDVVDVGNYFPLH
FT                   GMDAGLVDYLEAGLVAGNTQDARVVWHGPLNQYPYKDHSGIFQAAFTLSDAEFKFQPDW
FT                   PAVTSLELSALFENARMDLTIDSGDLLDVVVDGARISIPELGARSLLEIDAELATQGVA
FT                   ATEVIQASPLAESVGSTLAVVQVQGDVTATLDLSIPLYDGEEEQIRGLVNLDNTPIYIT
FT                   EPGVQLDGVTGQVSFVNEVVKGKDISALLYQQPVSLTFDTEQVRDNYGLNLDLKGVWQL
FT                   DELPAELDNPLMDFYSGEVNWNGAMTLIFDQTGYRIQAQVNSDLLGTELTLPPPFSKAT
FT                   DEKRRLSAELIGDNKQSSLGIKLGNQMEFWGGFDLESGDQLSHFDLLLGRLFKPGDQLK
FT                   RDQGHLQLDIAQTEFSPWLPIITSFTSAATSEINLAPIVPEPQSVPETEAVSAPELNPG
FT                   EKASVQQEQTRGFFPPLISIDADIGDLNLMGQTLSELTMTAAPFEELWRFEAQSKEFDG
FT                   RIDFYPDWSTQGLKMVAKKFHIAPAVKEEAKADFKSGTVLNNLPPLALDVDDFRLYGKP
FT                   LGHLVLQGTPKEGHYQIQTLSLTTPEVKLSGKGAWKNSEGENVTEFDVKLDATKFDALS
FT                   SILDMDPGLKDAPVEIDANISWQGAPYAFSLESLNGKINFELGKGHLSEVSDKGARIFS
FT                   LFSLDSLLRKLSLDFSDVFGKGLYFNSFTGTLEIDNGVIKTRDTEMDAVAGNMKVRGYT
FT                   DLVTESLNYDIRFVPQLASSVPTVVLLTTGGWTLGIGAFALTKVLEPVIEVITELRFRL
FT                   TGTMSEPKLEELERKSKEIEIPESALPRTKEGQPDNKQPAKKGAETQGVEKQEEKSQGA
FT                   DSRESSAPAKINESGVEILAPKVIEMPDFRETNSYPPASNEDKISPPKEAIDADQPVTV
FT                   PKQSRYSPKPAVYRVAA"
     gtgcctcgtc aattctgtcc ctttaagttt agccgtttct gctggcaaat attagcgatt        60
     atattggtgc tgtttgcctt ggctgtgagt ctctttcggg ggctcttgcc tcagctcgca       120
     gaggtaaggc aagagctggt caaatatgtc gaagagcagt atcaggttca ggttaacgta       180
     ggagagctca acgccgagtg gcaggccttt ggccccgcct taacggtaaa aaacttagta       240
     ctcccccctc aggaacgctt gccttttacc ctgataattc gtgatgtcca tgtcaagctc       300
     gatttctggg agagcttgat gacgaccagc ccccagattg aaaatgttat tttcgaaggg       360
     gtccaggttg ggctcgatct cgataaactc aatcaggctg gcccctcaac agtatctgca       420
     gaaaccgata ccgactggct atatcgtcta ctactagagc agttagaaca cttctcgata       480
     acggaggcca gcttacagtt actcagcaag agtcatgatt tcagacctat ctatgtcaaa       540
     gacttgagat ggcaaaacag gaacaacaaa catcagggcc agggaaaact ctacctcgat       600
     gaaaaagcct ctgaggtcga gcagctctct ctgtcgctgg agattgatgg taatggtttc       660
     aggcccgata cccttaaagg gcaagtttat ctcgcggcca gctctttgga tctgggcgag       720
     tgggcctcca gacaggcgaa tccatatgat gagaaaagca aactgcctct tgaaggtgta       780
     gtgaatctgc aggcctggtt gagcctgggg aatcggtcga tcgaatccgg actcatccag       840
     tttgagccta gctggctcga gtggcagtta aatgaagaag tgcaacattt tgaaatcaaa       900
     ggtgggcagt tcgagtggct accgattgat aagggttggc agttaagtag cagatcgctt       960
     gaatttgaaa ccaatgatcg accatggtct gagctcaact ttgttgcaca gcaacgaggc      1020
     gagcagctat cggcctatct gaatcgatta gacaccagta ccctgttacc cctgctaccc      1080
     ttagcgccaa aggtcgatct gcttgctctg aaaacctggc agtcgataaa cccccaaggt      1140
     tatctggata atatcaaatt ctctcttaat ggagatctgg gcccgcaagt ttcgctggat      1200
     attaatcagt tgcaatggcg aaactttgag agtatcccgg gcagtaaagc attagacttg      1260
     caggtcgcct ggtatgatga ttcactctat ttcaatgccc cggagcaagc ctacacctta      1320
     gattttagta cggctttcaa ggcgcctatc gtgctaaatg gcgccgcttt cgatgcccgg      1380
     tttaataccc aatatagtga attaacgctt cctcgccttc aatttagcaa taaagatatc      1440
     ggcatagacg cttccgtgaa aatggggttt gcaggtgaca ctcatcttgc gctacttgca      1500
     gatgtgaaga tcaatgatgt cgtcgatgtg ggtaattact ttccgctaca tggtatggat      1560
     gccgggttag tcgactatct tgaggccggg ctcgttgcgg gtaataccca agatgctaga      1620
     gtggtatggc atggtccatt aaatcaatac ccatacaagg atcattccgg gatctttcag      1680
     gcggctttca ccctgagtga tgctgagttc aagtttcagc ccgattggcc cgcggtaacc      1740
     tctcttgagc tatccgctct gtttgagaac gctcgaatgg atctcactat cgatagcggt      1800
     gatctcttag atgtcgtcgt cgatggggct cgtatcagta ttcctgaatt gggcgcgcgc      1860
     tccctgctgg agattgatgc cgagctggca acccaaggtg ttgcagcgac agaggtgatt      1920
     caagcctcac cactggccga gtctgtcggt tccacgttgg cggtggttca ggtgcagggt      1980
     gacgttaccg ccactttgga tctttcaatt cctctttatg atggtgaaga ggagcagatc      2040
     cgtggcttag tgaatctcga taacacacct atatatatca ccgaacctgg ggtgcagctc      2100
     gatggcgtga cggggcaggt gagcttcgtt aacgaggtgg tgaagggtaa agatatctcc      2160
     gctctgttat atcaacaacc agtttcattg actttcgata ccgagcaggt acgagacaat      2220
     tatggattga atctggatct taagggagtt tggcagctcg acgagcttcc ggccgagctc      2280
     gataatccct tgatggattt ctattccggt gaggtaaact ggaatggtgc catgacactt      2340
     attttcgatc agacgggcta ccgcattcag gctcaggtca atagcgatct gcttggtacc      2400
     gagttaacgc ttcctccacc attttctaaa gccacagatg agaagcgaag gctatctgcc      2460
     gagctcatcg gtgacaataa acagtcctcg ctggggatca agctgggcaa tcagatggag      2520
     ttctgggggg gattcgatct cgagtcgggt gatcaattaa gccacttcga tcttctgctg      2580
     ggacgcctgt ttaaaccggg cgatcaactg aaacgagacc aggggcatct gcagttagat      2640
     attgctcaaa cagagttttc cccttggtta cccattatta ctagtttcac ctcggcagcc      2700
     acttctgaga ttaaccttgc cccgattgtg cccgagcctc aatcagtgcc tgaaactgag      2760
     gcagtgtctg ctcctgagtt aaatccaggc gagaaggcat cggtgcaaca agaacaaacc      2820
     aggggcttct ttcctcccct tatcagcatc gatgctgata ttggcgatct gaatctgatg      2880
     ggacaaaccc tctctgaatt gaccatgacg gcggcccctt ttgaggagtt atggcgcttc      2940
     gaggctcagt ctaaagagtt tgatggaagg atagattttt acccggattg gtcgactcag      3000
     ggtctgaaga tggtcgccaa aaagtttcat attgcaccag cggtaaagga ggaagctaag      3060
     gctgatttta agtccggtac agtgctgaat aatttgccgc cactggcatt agatgtcgat      3120
     gactttcgtc tatatggaaa gcctttgggc cacctggtac tacaggggac gcccaaagag      3180
     gggcactatc agatacaaac tctctctttg accacgcccg aggtgaaact gagcggcaag      3240
     ggggcatgga agaacagcga gggcgaaaat gtcaccgagt ttgacgtgaa gttagatgcg      3300
     acaaaatttg atgcattatc ctctatcctc gatatggatc ccggcttaaa agatgcgccg      3360
     gttgaaatag atgccaatat ctcctggcag ggagccccct acgcgttctc tctcgagtcg      3420
     ctcaatggca agataaactt cgagctgggg aaagggcacc tgtctgaagt cagtgataaa      3480
     ggagccagaa ttttctcgct attcagctta gattccctgc taagaaaact ttcactcgat      3540
     ttctccgatg tattcggcaa aggcctctat tttaattcgt ttaccggtac tctggagata      3600
     gataacggtg tcattaaaac ccgtgatacc gagatggatg ccgttgcggg aaatatgaag      3660
     gtcagaggtt acactgactt agttaccgaa agcctgaatt acgatattcg cttcgtacct      3720
     caactcgcct ccagtgttcc tacggttgta ctgctcacca caggcggttg gacgctgggg      3780
     atcggggctt ttgccctgac gaaagtgctc gaacctgtca tcgaggtgat caccgagcta      3840
     aggttcaggc tgacgggaac catgtcagag cctaaactcg aagagttaga gcgcaagagt      3900
     aaagagatcg agatccccga gtctgcactg cctcgcacta aagagggtca gcctgataat      3960
     aaacagcctg ctaaaaaggg ggccgagact caaggggttg agaagcaaga agagaagagt      4020
     caaggagccg attctcggga gtcctctgct cctgctaaaa ttaacgaatc cggagtcgaa      4080
     attcttgcac caaaagtgat tgagatgcca gactttaggg agaccaactc ttatccccca      4140
     gccagcaatg aagataagat cagcccaccg aaggaagcaa tagatgcaga tcagcctgtt      4200
     acagtgccaa agcagtcgag atatagccca aaacctgcag tttatcgagt cgcagcttag      4260
//

If you have problems or comments...

PBIL Back to PBIL home page