(data stored in ACNUC7421 zone)

EMBL: CP000821.PE565

CP000821.PE565       Location/Qualifiers
FT   CDS_pept        689688..691109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0566"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: slo:Shew_0411 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35178"
FT                   /db_xref="GOA:A8FQQ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ5"
FT                   /protein_id="ABV35178.1"
FT                   /translation="MKFSHIALLSLAALGPFTAGAKEMGFSQAWQQLLTVSDKLQAGAQ
FT                   EVNRAEAEHEAGKDLYLPSISLNGSYTRLEKPIELDLNDLNPLASMDPSTLPPSIGGAL
FT                   AGIPSSMFVTQFTEQDIFRSSLQAMWPIYTGGKISAAQGIHAAHVIEKEQQLQLSTRDL
FT                   FIQLVDRYYGVAVTQSLAQTRGELVSSLEEHASHAQKLEEQGQIAKVERLNAQVALENA
FT                   KVNFASAVRQAEMAVIALSRMLHEHEVDTTSALFMLADAPSLPHLSQLTLVQHPALKLL
FT                   EAKEEQANGLIDLEKGKYHPTVFLYGNYTLYEDDSLFSKMEPDWMLGVGVKVPLLSRDG
FT                   RSGKVQAAKSALLQARYTKAQTRQDLSLLLDQSYRQLLQAQEEVLSLETSLSLAQENKR
FT                   LRDLAFRQGLSTSIEKVDAELKLTAVETQQLGAKYRYIQAYARLMAISGQLEEFLGRSV
FT                   SHHTNVAMQESNNAG"
     atgaagtttt cacatatagc cttattgtcg ttagcggcac tagggccttt cacggctggg        60
     gcgaaagaga tggggttctc tcaagcttgg caacagctgt taacggtaag cgataagttg       120
     caagccggtg ctcaggaagt taaccgcgcc gaggccgagc atgaagccgg aaaggatctt       180
     tatcttccct caattagtct caacggaagc tatacacgac tcgaaaagcc gatcgagtta       240
     gatcttaacg atcttaaccc tctcgcctct atggatccca gcacactccc gccgtctatc       300
     ggtggtgccc ttgccggtat accaagctct atgtttgtca cccaatttac cgaacaagat       360
     atctttcgtt ccagtctcca ggcgatgtgg cctatctata cgggaggcaa gatctctgcg       420
     gctcagggga tccatgccgc acatgtgata gaaaaggagc agcagttaca gctctctacc       480
     cgtgatctct ttattcaact ggtggatcgc tactatggcg ttgcggtgac tcagtcatta       540
     gcgcagaccc gtggtgaatt agtctcctcc ctcgaagagc atgccagtca tgcacagaaa       600
     ctcgaagagc agggacagat agcgaaagtc gaacggctca atgcgcaagt tgcactggaa       660
     aatgccaagg tgaactttgc cagtgccgtg cgtcaagctg aaatggcagt tatcgcccta       720
     tcacgtatgc tccatgaaca tgaagtggat accacatccg cgctgtttat gctcgccgac       780
     gccccctctc tgccgcacct gagtcaactg actctggttc aacatcctgc gctgaaactg       840
     ctcgaagcga aagaggagca ggccaatgga ttgatcgacc tggaaaaagg taagtatcac       900
     cctacggtat ttctctatgg taattacacc ctgtatgaag acgatagcct gttttctaag       960
     atggagcctg attggatgct gggcgtcgga gttaaagtgc cgttactgag tcgagacgga      1020
     cgcagtggca aggtacaggc ggctaagagt gcattgcttc aggcaagata taccaaggca      1080
     cagacccggc aagatctcag cctgctactg gatcaaagtt accgtcagct gttacaagcc      1140
     caagaggagg tattatcgct ggagacctct cttagtttgg cacaagagaa taagcgcctg      1200
     agagacctgg cttttcgtca ggggctatcg acctcgatcg aaaaggtcga tgcagaactg      1260
     aagcttactg cggtagaaac acagcagctg ggtgctaaat atcgttatat tcaggcgtat      1320
     gccagactca tggccatcag tggccaattg gaagaatttt taggtcgcag cgttagtcat      1380
     catactaatg tcgcgatgca ggagagtaac aatgcaggct aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page