(data stored in ACNUC7421 zone)

EMBL: CP000821.PE566

CP000821.PE566       Location/Qualifiers
FT   CDS_pept        691099..692070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0567"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="KEGG: slo:Shew_0412 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35179"
FT                   /db_xref="GOA:A8FQQ6"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ6"
FT                   /protein_id="ABV35179.1"
FT                   /translation="MQANRIIGVVAIIGLVGALGYGLKLAYTPQDERIQGQIEAREYNI
FT                   SSKVPGRVEQVLVRRGDKVEAGDLLFAIDSPELSAKLMQAEGGRDAAQAMQLEADTGAR
FT                   KQQVMASKEQWLKAKAAATLAKTTYDRVEVLFVEGVLARQKRDEAFTQWQAAKYTEQAA
FT                   LAMYEMANEGAREETKAAAAGNARMAEGAVNEVSAILADSQMRAPKSGEISEVLLQPGE
FT                   LAPSGFPVVSIIDMDDAWAVFQVREDQLKEFKMGQKHLIFIPALGGEYEFSVTHISVMG
FT                   EFATWRATESGHDFDMRTFEMELRPVKTIPDLRVGMTTLMAQ"
     atgcaggcta atcgtattat tggggttgtg gcaattattg gcctggttgg agcgttaggg        60
     tacggcttaa aactggccta tacacctcag gatgaacgca tacagggtca gattgaggcg       120
     agagaataca atatctcctc aaaggtaccg ggtagggtcg agcaggtgtt agtgcgtcgt       180
     ggggataaag ttgaagcggg cgatctgtta tttgccatcg acagtcccga gttgagtgca       240
     aagttaatgc aggccgaagg tggcagagat gcggctcagg cgatgcagct tgaagccgat       300
     accggtgccc gaaagcagca ggtgatggcg tcgaaagagc agtggctgaa ggcgaaagcg       360
     gcggccacac tggccaagac cacatacgac cgcgtcgaag ttctgtttgt cgaaggtgtg       420
     ctggcaagac agaaacgcga tgaggcgttc actcaatggc aagctgccaa gtatacggaa       480
     caagctgccc tggccatgta tgagatggca aatgaaggtg cgcgtgaaga gacaaaagct       540
     gccgctgcag gtaatgcccg catggcggaa ggtgcggtga atgaggtcag tgcaatattg       600
     gccgatagcc agatgcgcgc ccctaagtca ggtgagataa gcgaagtgct gctacagcct       660
     ggtgaactcg cgccaagtgg attcccagtg gtaagtatca tcgatatgga tgatgcctgg       720
     gccgtgtttc aggtgcgtga agatcagcta aaagagttta agatgggtca aaaacatctc       780
     atctttatcc cggccctcgg aggagagtac gaattctcgg taactcatat cagtgtgatg       840
     ggagagttcg ccacctggcg tgccaccgag agcggccatg atttcgatat gcgcaccttc       900
     gagatggagc ttcgtcccgt gaagacgatt cccgatctca gagtcggcat gactaccttg       960
     atggcgcaat aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page