(data stored in ACNUC7421 zone)

EMBL: CP000821.PE569

CP000821.PE569       Location/Qualifiers
FT   CDS_pept        complement(694715..697270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0570"
FT                   /product="Ig domain protein, group 1 domain protein"
FT                   /note="KEGG: sbl:Sbal_3807 Ig domain protein, group 1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35182"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ9"
FT                   /protein_id="ABV35182.1"
FT                   /translation="MRLIKTAFALPLSFLLLSSLGGCNGASDDSGGENTGEYALSLSYK
FT                   TVVDGKCADATNDLSFANNASICAVAKLTQGGSNSNGGLISFSATLGELSPATKLTDTQ
FT                   GIAEVILGNAQASLGAGTLTAQFDTKAAENNILAVNRNYEFVDDGIPDEDTPKISASII
FT                   NGAATVTQFKVDETVQLQAQFLDSSSQGIAQQIVTFSAGSTTLNPNTALTNEQGIAQVS
FT                   YTPSENELGAASLNVSLSYKDQGYQENSLYEVLPANAIGDDGVLKLGHFDDNNNFIEDE
FT                   LATTLTPVDGKYRISAGGSFGITATLVSVADDGTITRVQTPSSISFGSDCVTSNNASLD
FT                   TPVTTLSGSAGSTFQDTSCSGNSERDDQIVATTQAGNQTLTANLPFTLERQTLASLSFL
FT                   SAEPKNIRIKGAGGTGSTESSLVTFKVTSSNGQPAAQQAVKFTLDTVVGGLSFSNGAAT
FT                   DESLTNSQGIASIRVLAGTMPTPVRVLASATDTDTNETITSQSEQLTVNTGLPQQLGFS
FT                   ISTSMFNPEAGDFNGEKVTLTAYASDTFGNPAPDDTTINFTSEGGQIVPSCLTVNGSCS
FT                   VEWTSANPRVPDHRITVLAYALGHETFFDTNGNNVFDDKDVTVDAEGKPVVDKACLNSD
FT                   GQAIHCSGNGMDIEAYLPSGFSDLGDAFRDDDESFSYTPGEKYFNTTSSGEYQIPDGKF
FT                   NGPQCQSTIVGCEPNTYIRKALVMTMSGSSAGFTIWQGNNLIRDDFGLATGSIVPLTAI
FT                   AAGESSSFTVQFYDSAYQIMPASTQVAVEASAGELIFDAFEVANTTRRGGTTTGFIITN
FT                   DIDPGSTGEPAKLSSVSINLTTPKNFKSGAGLSITLSGT"
     atgcgactga taaaaactgc ttttgctctc cctctttcat tcttgcttct atcttctctg        60
     gggggctgta atggcgcttc cgatgatagc ggtggagaga atacaggaga gtatgccctc       120
     tcactgagtt ataaaacggt tgtcgacggc aaatgcgccg atgcaaccaa cgacttgagc       180
     tttgccaata atgccagcat ctgtgcggtg gccaagttaa ctcagggagg gagtaacagt       240
     aacggtggtt taatcagttt cagcgcaact ctaggtgagc tgagtcccgc aactaaacta       300
     acagatactc aaggtattgc cgaagtcata cttggtaatg ctcaagcctc tctgggtgcc       360
     ggaacgctaa ccgcgcaatt cgatactaag gcggcagaga ataatatcct tgcagtcaat       420
     cgtaactatg agtttgtcga cgacggcatt cccgatgaag atacgccaaa aatcagcgcc       480
     agcatcatta acggtgccgc gacggttact cagtttaagg tcgatgaaac ggtacagctt       540
     caggcacagt tcttagacag ttcgagccaa ggtattgctc agcagattgt cacctttagt       600
     gcgggaagca ccaccctgaa tccgaatacg gcgctcacta acgagcaggg tattgcacaa       660
     gtcagctaca ccccatcaga gaatgaactg ggtgcagcca gcctgaatgt ctctttgagc       720
     tataaagatc aaggctacca ggaaaacagc ctctatgagg tactaccggc aaatgcgatt       780
     ggtgatgacg gtgtccttaa attgggacac tttgatgaca acaataattt tattgaagat       840
     gagctagcca ccacgcttac ccccgtcgat ggtaaatatc gcatcagcgc gggtggtagt       900
     ttcggcatca cggcaacctt agtcagcgtg gccgacgatg gcaccattac ccgggttcag       960
     accccctcat cgataagctt tggctccgat tgtgttacca gcaataacgc cagtctggat      1020
     accccggtca ccacactatc gggcagcgcc ggctcaactt tccaggatac cagctgtagc      1080
     ggtaacagtg aacgtgacga tcagatagtc gcgaccactc aggccggtaa tcaaaccctg      1140
     acggcaaacc tacccttcac cttggagcgt caaacgctgg cgagtctgag cttcctttcg      1200
     gcagagccta agaatattcg catcaagggc gcaggcggca ccggcagcac agaatcatct      1260
     ctggtaacct ttaaggtaac cagctctaac ggccaaccgg cagcgcagca ggcggttaag      1320
     tttacgctcg acacggttgt cggtggatta agcttctcaa atggcgcggc caccgacgag      1380
     agcctgacca actcgcaagg tattgccagc attcgcgttc tggctggtac catgccgacc      1440
     ccggtgcgtg tacttgcctc ggccaccgac actgacacaa atgagaccat caccagtcag      1500
     tctgagcagc tcacagtcaa taccggcctg cctcaacagc ttggcttcag tatatcgacc      1560
     agcatgttta acccggaagc gggtgatttt aatggtgaaa aggtgacgct aacagcttat      1620
     gcctcagaca ccttcggtaa cccagctccc gatgacacca ccatcaactt taccagcgaa      1680
     ggtggccaga tagtccccag ctgtctgaca gtcaacggca gctgtagcgt cgagtggaca      1740
     tcggcaaacc caagggttcc ggatcatcgc atcaccgttc ttgcctatgc gcttggacat      1800
     gagactttct tcgatactaa cggcaataac gtcttcgatg ataaagatgt cactgtagat      1860
     gccgagggca aacctgttgt agacaaggct tgtttaaata gtgacggaca agccattcac      1920
     tgctcaggca atggtatgga tatcgaggcc tacctaccga gtggtttcag cgacttaggc      1980
     gatgccttcc gtgatgatga cgagagcttc tcctatacgc ctggtgagaa gtacttcaac      2040
     accacaagca gtggcgaata ccagatccct gatggtaagt tcaacggccc tcaatgtcag      2100
     tccacaatcg ttggctgcga acctaatacc tatatccgca aggcgctggt tatgaccatg      2160
     tccggttcga gtgcaggctt caccatctgg cagggcaaca atttaatccg cgatgatttc      2220
     ggtctggcaa cggggtcaat tgtgccatta acggcgattg cagccggaga gtcatcgagc      2280
     ttcactgtgc agttctatga cagcgcttat cagatcatgc cagccagcac tcaggtggca      2340
     gtcgaagcct cagcaggaga gcttatcttc gatgcatttg aagttgctaa cacgacgcgt      2400
     cgcggcggca ctacgactgg cttcattatc actaacgata tcgatcctgg cagtacagga      2460
     gagcctgcaa aactcagcag cgtgagcatt aacctgacaa caccgaagaa ctttaaatcg      2520
     ggtgcggggc taagcatcac cctatcgggt acctaa                                2556
//

If you have problems or comments...

PBIL Back to PBIL home page