(data stored in ACNUC7421 zone)

EMBL: CP000821.PE57

CP000821.PE57        Location/Qualifiers
FT   CDS_pept        complement(68291..69085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0057"
FT                   /product="flagellin domain protein"
FT                   /note="KEGG: shw:Sputw3181_0483 flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34670"
FT                   /db_xref="GOA:A8FP97"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP97"
FT                   /protein_id="ABV34670.1"
FT                   /translation="MLSVQTNNASNIAQNSVNKSNDLLSNAMERLSTGLRINSAADDAA
FT                   GLQIATRMNANVVGMETANRNVSDATSMLQTADGALDELTTIANRQKELATQAANGVNS
FT                   TEDLAALDAEFQELSKEVTRIVTDTEYSGNKLFAELEAGVTFQIGASSGETLDVTTNAI
FT                   TAVAGDLKAGANAAIDLVDTFIDEVGAERSTLGANINRLGHTASNLTNVTENTKAAAGR
FT                   IMDTDFAVETANMTKNQLLVQAGTNILSSANQNTGLVMSLLG"
     atgttatctg ttcagactaa taatgcatca aatatcgcac aaaactcagt aaacaaaagc        60
     aacgacctac ttagcaatgc catggagcgt ctatctacgg gtctacgaat caacagcgcg       120
     gccgacgatg ctgcgggtct gcagattgca acacgtatga acgctaacgt agtcggcatg       180
     gaaacggcta accgtaacgt atctgatgcg acctctatgc tacagactgc cgacggcgca       240
     ctggatgaac ttaccactat cgctaaccgc cagaaagagc tggcgactca agcggctaac       300
     ggcgtgaact caacagaaga tctggcggca ctggatgctg aatttcagga actatcgaaa       360
     gaagtaacac gtatcgttac tgataccgaa tactcaggta acaagctgtt tgcagagtta       420
     gaagcgggcg ttaccttcca gataggtgct tcaagtggtg aaactttaga tgtcaccaca       480
     aatgcaatta ctgcagtagc cggcgacctt aaagcgggcg cgaatgccgc tatcgatctt       540
     gttgatacct tcatcgacga agttggtgct gaacgctcaa cactaggtgc taacatcaac       600
     cgcctgggtc acacagcctc taacctgact aacgtcaccg agaatactaa agccgcagca       660
     ggccgcatca tggacactga ctttgctgtt gaaactgcaa acatgaccaa gaaccagtta       720
     ttggttcaag ctggtacgaa tatcctatca tcagccaacc aaaacactgg tttagtaatg       780
     agcctgttag gttaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page