(data stored in ACNUC7421 zone)

EMBL: CP000821.PE570

CP000821.PE570       Location/Qualifiers
FT   CDS_pept        complement(697353..697892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0571"
FT                   /product="protein of unknown function DUF615"
FT                   /note="KEGG: slo:Shew_0415 protein of unknown function
FT                   DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35183"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR0"
FT                   /protein_id="ABV35183.1"
FT                   /translation="MKIVGDSEHFKQPFDHDEEYVSRAEAKREIAVYQELGIKLVALSK
FT                   SQIKKLNLDELLFDNVMKTKTIKINTEAYRRQLQFIGKIMRNVDIEALQLDIKNVLNQN
FT                   SNESAKQNVAEKLKEQLLSEGDAAVQDLLEKHPQLERQKLRQLIRQSIKELAKKPDEAS
FT                   KSSIELVKYLRNEISE"
     atgaaaatag tcggtgattc agaacacttt aaacagccct ttgaccatga tgaagaatat        60
     gtcagcagag ctgaagcaaa acgtgaaata gcggtttacc aagagcttgg tatcaagcta       120
     gttgcattaa gtaaaagcca aattaagaag ttaaatttag acgagctttt atttgataat       180
     gtaatgaaaa ctaagacgat taaaatcaat accgaagcct atcgtcgtca gttgcagttt       240
     attggcaaga tcatgcgtaa tgtcgatatt gaagcattac agctcgatat taagaatgtg       300
     ctgaatcaga acagtaacga aagcgcgaag caaaatgttg ccgagaagct gaaagaacag       360
     ttgctaagtg aaggcgatgc tgccgttcaa gatctgctcg agaagcaccc tcaactggaa       420
     agacagaagt tacgtcaact tatccgtcag tcaattaaag agctggctaa gaaacccgac       480
     gaggcttcaa aatcttcaat cgaattggtc aaatacttac gaaatgagat atctgaataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page