(data stored in ACNUC7421 zone)

EMBL: CP000821.PE574

CP000821.PE574       Location/Qualifiers
FT   CDS_pept        700791..701840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0575"
FT                   /product="arsenical-resistance protein"
FT                   /note="KEGG: slo:Shew_0418 arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35187"
FT                   /db_xref="GOA:A8FQR4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR4"
FT                   /protein_id="ABV35187.1"
FT                   /translation="MGLFERYLSVWVGLAIVLGVILGNLMPDVFALVAAVEYAHVNLVI
FT                   AVLIWVMIYPMMVQIDFAAVKDVRKSPKGLVLTLVVNWLIKPFTMALLGWLFFKVLFVE
FT                   WVDPQTATEYIAGMILLGVAPCTAMVFVWSQLTKGDPNYTLVQVSVNDLIMVVAFAPIC
FT                   AFLLGVSDIQVPWETLLSSVFLYVVLPLVAGVLTRKKLESDGDPASLARFVSNLKPWSI
FT                   VGLLATVVLLFGFQAETILNEPQNILLIAIPLLIQTYGIFFIAYYAAKKLKLSHKVAAP
FT                   ACMIATSNFFELAVAVAISLFGLHSGAALATVVGVLVEVPVMLSLVAFVNRNRKQFEDD
FT                   RDEHQAASE"
     atgggactgt ttgagcgtta tctgagtgtt tgggttggac tagctattgt ccttggggtg        60
     atcttaggta acctgatgcc ggatgttttt gccctggttg ccgcggttga atacgcacac       120
     gtaaacttag tcatcgccgt gcttatctgg gtgatgatct accctatgat ggtgcagata       180
     gactttgcgg ccgtcaaaga tgtgcgaaaa agccctaaag gcttggtact gactctggtg       240
     gttaactggt taattaaacc atttaccatg gcactgctgg gttggctgtt cttcaaggtg       300
     ttatttgtcg agtgggtcga cccacagacg gcgaccgaat atattgcggg tatgatccta       360
     ctcggtgtcg ccccctgtac ggctatggtg tttgtttgga gccagcttac taagggcgat       420
     cctaattaca ccttagtaca ggtatctgtt aatgacctta tcatggtggt tgcctttgcc       480
     cctatctgtg ccttcctgct tggggtcagc gatattcaag tgccctggga aaccctgctc       540
     tcgtcggtat ttctctatgt ggttctgccg ttagtcgccg gcgtattgac tcgcaaaaag       600
     ctggagtccg atggcgaccc cgcgtccctc gcccgatttg tgagtaacct gaagccctgg       660
     tctatcgtgg gtctgctggc gacggtcgtc ctgctgtttg gatttcaagc cgagaccatc       720
     cttaatgagc cacagaacat cctgttgatt gctatccctc tgctcattca gacctatggc       780
     atattcttta tcgcctacta tgcggccaag aaactaaagc tatcccataa ggtagcggcc       840
     ccggcctgta tgattgcgac ctctaacttt ttcgagcttg cggtggcggt cgccatctca       900
     ctgtttggac tacactcagg tgcagcactg gcaactgttg tcggggtgtt ggtggaggtg       960
     ccggtgatgc tgtcactggt ggcatttgta aatcgaaaca gaaagcagtt tgaagatgac      1020
     agggacgaac atcaggctgc ctcagaatag                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page