(data stored in ACNUC7421 zone)

EMBL: CP000821.PE578

CP000821.PE578       Location/Qualifiers
FT   CDS_pept        complement(705321..706250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0579"
FT                   /product="putative LysR-like regular protein"
FT                   /note="KEGG: vpa:VP2406 putative LysR-like regular protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35191"
FT                   /db_xref="GOA:A8FQR8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR8"
FT                   /protein_id="ABV35191.1"
FT                   /translation="MTNEINWKSTDLNLLVTFSYLYRYRSVSIAADKSHVSQSAMSHSL
FT                   ARLRILFDDQLFERKGHHMEPSEYAHHIAPIVGQLLDDISHRLLAKEQFTPLSYSGECR
FT                   IGLTDYAEFIFAPSLYDAIQASAPKSQVSFINVNRHNYVNIADQDKLDVVIGSMPQPHS
FT                   DFDSKFLYTEKHVCLCDSQLFSNNQTLTVAEFAAVEQALVSPDGTLVTQVDKRLADLGL
FT                   TRKVSVASRNFLTIRSLLKKRKLIAIVPELMAKAQGFDDQLTALTPPVDIADFEISLLW
FT                   KSKLTNNDKNSWLRSVVQNVLSNAKSQS"
     atgacgaacg agataaactg gaagagtacc gatctgaatt tactagtcac cttttcctat        60
     ctgtaccgtt atcgcagtgt gagcatcgcc gcagataaga gtcatgtcag tcaatccgca       120
     atgagccata gtctcgcccg tttacgcata ttatttgatg accaactatt cgagcgtaag       180
     ggacatcaca tggagcccag tgagtacgcc caccatattg ccccgatagt ggggcagttg       240
     ttagatgaca tatcacatcg attattggcc aaagagcaat ttacaccgct aagctactcg       300
     ggagaatgcc gtattggttt aaccgattat gccgagttta tttttgcgcc ttcactatat       360
     gacgccatac aggcaagcgc gccaaaatct caagtgagct ttatcaatgt caaccggcat       420
     aactatgtca atattgcaga tcaagataaa ttagatgtgg tgattggaag tatgcctcag       480
     ccgcattcag actttgacag taaatttttg tataccgaaa agcatgtttg cttatgtgac       540
     agtcaactgt tttccaataa ccaaactctc acagttgcag aatttgccgc cgttgaacaa       600
     gcattagtca gcccagatgg aaccttagtg acgcaagtgg ataagaggct ggcggattta       660
     gggctaacaa gaaaagtgtc tgtcgcgtca cgcaactttc tgacgattcg aagcctactg       720
     aaaaaaagaa aattaatcgc aatagtgccg gaattgatgg caaaagcaca gggcttcgat       780
     gaccagctca cggcgctgac tccccccgta gacatagccg attttgaaat ttccttgctg       840
     tggaaaagca agctaaccaa caatgataaa aactcctggc tacgttctgt ggtgcaaaac       900
     gttttgtcca atgctaaatc tcaatcatag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page