(data stored in ACNUC7421 zone)

EMBL: CP000821.PE579

CP000821.PE579       Location/Qualifiers
FT   CDS_pept        706356..707492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0580"
FT                   /product="chromate resistance protein-related protein"
FT                   /note="KEGG: vpa:VP2407 chromate resistance protein-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35192"
FT                   /db_xref="GOA:A8FQR9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR9"
FT                   /protein_id="ABV35192.1"
FT                   /translation="MLSIFKAFFALGWISFGGPAAHIGYFRITFVEKLKWLDDKEYGQI
FT                   VALSQFLPGPGSSQVGFALGYKRGGLGGACLAFIGFTLPSVLIMLVLAVLSSQLTTTPM
FT                   FQSIVHGLKLLAVIVVADATIGMYKNFCRQKLTIGLCIATAVSLLVFPGIATQMLVLAI
FT                   AAIIGAKMLANQQANIDQSFRPSVAPLVLFVLLLIGLPFVAQQLPMLALFSDFYQAGSL
FT                   VFGGGHVVLPLLQNIVGDQISQDTFLTGYAVAQAVPGPMFTFATFIGYELLPDAPLFGS
FT                   LIATLGVFLPGFLLLLGVLRNWQQLASNKLVSGAINGVNAAVVGLLVAALYQPVFSSAV
FT                   VDGLDFALILVGFFLLKQLKLPIVAMVVFYIITGVILL"
     atgttgtcaa tttttaaggc ctttttcgcg ttaggctgga tcagctttgg cggacctgcg        60
     gctcacattg gttactttag aattactttt gtcgagaagc tgaaatggtt agacgataaa       120
     gagtacggcc aaatcgtcgc actgagtcag tttttgcctg gcccaggttc gagccaagtc       180
     ggttttgcct tgggctataa gcgtggaggc ctcggcggtg catgtttggc tttcattggt       240
     tttaccttgc cttctgtgtt gattatgctg gtcttggctg tccttagtag tcagctcacc       300
     actacgccaa tgtttcaaag tattgtccac ggccttaagc tactcgccgt gattgtggta       360
     gctgatgcca ctataggaat gtacaaaaac ttttgtcggc aaaaactgac tattggtctt       420
     tgtatagcca cagctgtctc cttactggta tttcccggca tcgcgaccca aatgctggtg       480
     ctggctattg ccgctatcat tggtgccaag atgttagcta accaacaagc taatatagac       540
     cagtcattca ggccctctgt tgcgccttta gttctgtttg ttttgctatt gattggctta       600
     ccctttgtcg ctcaacagtt acctatgctt gccctattta gtgactttta ccaagccggg       660
     agtttggtat tcggtggcgg acatgttgtg ctgccattac tgcaaaatat tgttggtgac       720
     caaataagcc aagacacttt cttaactggc tatgctgtag cgcaagctgt gccgggacca       780
     atgtttactt ttgcaacctt tattggctac gaactattgc ccgatgcgcc actgttcggg       840
     tcactgatcg cgacgctggg cgtgttctta cctggttttt tactattact tggcgtgcta       900
     agaaattggc aacaattggc gagtaataaa ttggtttcag gtgcgattaa cggcgtaaat       960
     gcggctgttg ttggcttgct ggttgccgca ctttatcaac cggtatttag cagtgcggtg      1020
     gttgatggcc tggatttcgc attgattttg gttggttttt tcttactcaa gcaactaaag      1080
     ctcccgatcg tcgccatggt ggtgttttac attatcactg gagtgatatt gctttaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page