(data stored in ACNUC7421 zone)

EMBL: CP000821.PE58

CP000821.PE58        Location/Qualifiers
FT   CDS_pept        complement(69675..70700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34671"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP98"
FT                   /protein_id="ABV34671.1"
FT                   /translation="MVNGISDSLNVQQRSQPLVAATNDRHQSKAPKPAQLTAIPSHRLE
FT                   TYARWARVTQGQHKISAFQVAEQGLKQIFHLLKQLKRLAQSAISLSGESRNAQIKAATS
FT                   LQQRLSQLRVEYQNRPLLDHQLNLISKKRPPAPRQFILKSIELAQPKPRDERIQIQSDK
FT                   DSISIFLPANASKAALTGHLSEAMHNLEITIPAPHSETTVFNCNDERWQKIKAGIMMTG
FT                   KGQRLPAGEARTIKVDEILSWQDPREWRLGSNEDLKQTVVKIHKSLFKLEQQLRELTQT
FT                   ADKIQRQLHKANKENDFDDELKKTLNSLERLMQATPFTLQMTSVMAQANVTRSQVSSLL
FT                   L"
     atggttaatg gaatttccga tagcttaaat gtccagcaac gtagtcaacc cctcgttgct        60
     gcaacaaacg acaggcatca aagtaaggca ccaaagcctg ctcaactcac agccattccc       120
     tcccataggc tggagaccta cgcgcgctgg gcaagagtca cccaaggaca gcataaaatt       180
     tcggctttcc aggtggcgga gcaaggcctt aaacagattt ttcatctgtt aaaacagctc       240
     aagcggctag cgcagagcgc gatcagttta agcggtgaga gtcgtaatgc tcaaattaag       300
     gcggcaacgt cattacaaca acgcctctca caacttagag ttgaatatca aaacaggccg       360
     ctgctggatc accagttaaa tctcatctcg aagaaacgtc ctccggctcc ccgtcagttt       420
     atactgaagt cgattgagct ggctcaacct aagccaagag acgagcgtat acagatccaa       480
     tcagacaagg actctatctc tatttttctt ccggcaaacg cctccaaagc ggcccttacc       540
     ggtcacctat ccgaagccat gcataatctt gagatcacga ttcccgctcc tcactctgag       600
     acgactgtgt tcaattgtaa tgatgaacgt tggcagaaga taaaagccgg cattatgatg       660
     actggtaagg gccagaggct gccagccgga gaagccagaa ccataaaagt tgatgaaata       720
     ctcagctggc aggatccaag agagtggcgc ttaggtagta acgaagatct caagcaaacg       780
     gtggttaaaa tccataagtc tctgtttaaa ttggaacagc aattgcgaga attaacacaa       840
     acagcggata aaattcaacg tcaacttcat aaggccaaca aagaaaacga ctttgatgat       900
     gagctaaaaa aaacactcaa cagcctcgaa cgcttaatgc aggcgacccc tttcacattg       960
     cagatgactt cggtgatggc tcaggctaat gtcacccgct ctcaggtctc ttcactactg      1020
     ctctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page