(data stored in ACNUC7421 zone)

EMBL: CP000821.PE580

CP000821.PE580       Location/Qualifiers
FT   CDS_pept        complement(707643..709520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0581"
FT                   /product="GGDEF domain"
FT                   /note="KEGG: sdn:Sden_2587 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35193"
FT                   /db_xref="GOA:A8FQS0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS0"
FT                   /protein_id="ABV35193.1"
FT                   /translation="MFFLLMKKWLTWLGCVLFVFSTNGFASDALTELERAAKAVSPADG
FT                   IELLNKFDLKNSKLEAEQQAKVYYLYGQLYEKTRQLDQSIASYDKGIELVKYLPITDVL
FT                   IDSHLERSFALYLQSNDPAAYCVDRKQALVYARLHHNSELLAKTLTQNAFCFNEPKSIH
FT                   KGIALLDEAMAIVDKNNLNVNRKALIYNATGSLYRQVGLHRRGYDSFEKAYQTWQSIND
FT                   IEDMFNMQYNMLSEAISLGHWDKASQSVEAQFSLAAMSTGDNDMLFFSHLNAGRVALRT
FT                   YDYDKAVLHLEKAVSLNHTTQEKYFISSNYLYLGLAYMRSGEAEKAADMARTFKQDDSF
FT                   AANQKAMLLQADAIIALDEHDPVNALNKLFQVIDIEREINQSVIDNEVISLSLDHNSAL
FT                   AEFENELLGNRLAINELSLASVKDKERINELKLSLFFIIVTVLFCIVLFLLISRRTLKV
FT                   RAQTDFLTGLANRGHTFKKGQKIIEKTIKKQQPASVIMFDIDDFKSINDRYGHHIGDLA
FT                   IKSVSKRTRRWLKKHDLVGRIGGEEFLIVLENTSQTEAYDIADRLRHNIEEQFFQFDDV
FT                   TVELTISLGVAALNEHTTTLIGLMKQADDALYRAKFSGKNKVYLAAECA"
     atgttttttt tactgatgaa aaagtggctg acttggttgg gctgcgtact tttcgttttt        60
     agtacaaatg gatttgctag tgatgcgtta actgaattag aacgtgcagc caaagcggtt       120
     agcccggctg acggtatcga gttgttgaat aaatttgatc taaaaaacag caaacttgaa       180
     gctgagcaac aagcgaaagt atactatctc tatggtcagc tttatgagaa aacccgtcaa       240
     ctcgatcaat caatcgccag ttatgacaaa ggcattgaat tagttaaata cctgccgatt       300
     actgatgtgc ttatcgatag tcatttagag cgttcatttg cgttatattt gcaatccaac       360
     gaccccgcgg catattgcgt cgatagaaaa caagcccttg tttatgctcg cctacaccat       420
     aattccgaat tacttgctaa gaccttaact caaaatgctt tttgctttaa cgaacccaag       480
     tcgatacata aagggattgc cttgctcgat gaagcgatgg ctatcgtcga taaaaacaac       540
     cttaatgtaa atcgtaaagc gctgatttat aacgcaacag gcagcttgta tcgccaagta       600
     ggactacatc gacgtggtta tgacagtttt gaaaaagctt atcaaacatg gcaaagcatt       660
     aatgacattg aagacatgtt taatatgcaa tacaacatgt tgagtgaagc cattagtcta       720
     gggcattggg ataaagcaag tcaaagtgtt gaagcacagt tttctttggc agccatgtct       780
     acaggcgata atgatatgtt gtttttttct cacttaaatg ctggacgtgt agcattgcga       840
     acgtatgatt atgataaggc tgttttacat ttagaaaagg ctgtttcact taatcataca       900
     actcaagaaa agtattttat tagcagtaac tacctctatt taggcctagc ttatatgcga       960
     agcggtgagg ctgaaaaagc cgctgatatg gcacgaacct ttaaacaaga cgatagcttt      1020
     gctgcaaacc aaaaagcgat gttgctccaa gctgatgcca tcattgcact tgatgagcat      1080
     gacccagtta atgcactgaa taagctattt caagtgatag atatagagag agagattaat      1140
     caaagtgtga ttgataatga ggtgatcagt ttatcgctcg atcataattc tgcattggct      1200
     gagtttgaaa atgaattgct gggtaatcgt ttagccatta atgagttgag tttggcttct      1260
     gtaaaagata aagagcggat taatgagctt aaactaagtt tgttttttat tatcgtcacc      1320
     gtgctatttt gcattgtttt atttttatta atctcacgta gaacgcttaa agtgcgtgcg      1380
     caaaccgact ttttaacggg gcttgctaac aggggacata ccttcaaaaa aggccaaaaa      1440
     atcattgaaa aaacaattaa gaagcaacaa ccagcatcag tgattatgtt tgatattgat      1500
     gactttaaat cgattaatga tcgttatggg catcatatcg gtgatttagc gataaaatcc      1560
     gtctcaaaac gaaccaggag atggcttaag aagcatgatt tagtgggcag gatcggcggt      1620
     gaagagtttt taattgtgct tgaaaacacc tcacaaactg aggcttatga tattgctgac      1680
     cgacttagac ataacatcga ggaacaattt tttcaatttg atgatgtaac tgttgagtta      1740
     accattagtt taggtgtcgc agcattaaat gaacatacaa caaccttaat agggctgatg      1800
     aaacaagcgg atgatgcgtt gtatcgagct aaattctcag gtaagaataa ggtttactta      1860
     gcggctgaat gtgcttaa                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page