(data stored in ACNUC7421 zone)

EMBL: CP000821.PE583

CP000821.PE583       Location/Qualifiers
FT   CDS_pept        712221..713600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0584"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: slo:Shew_0424 amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35196"
FT                   /db_xref="GOA:A8FQS3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS3"
FT                   /protein_id="ABV35196.1"
FT                   /translation="MEGITEFVSMINGFVWGTPMLVMILGVGLFLSVGLKLMPILKLGT
FT                   GFKLLWSGRIPDKDKTMEGEISPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMW
FT                   CTALVGMATKFAEAVLAVKYREVDDNGDHIGGPMYYIKNGLGSKWAWLGTAFALFGSFA
FT                   GFGIGNTVQSNSVADALSSNFGVPTWATGVVLMMLVGAVLMGGIKRIADVAGKLVPLMT
FT                   LFYIAAGLAVLAVNAAAIPDAIVMIVHSAFNPVAAQGGFAGAAVWAAIRFGVARGVFSN
FT                   EAGLGSAPIAHASAQTNNPVAQGLVAMLGTFIDTLIVCSITGLAIIVSGAWTSGENGAA
FT                   LTSLAFSTAIPMGNYIVAVALSVFAFTTILGWSVYSEKCVQYLFGVKAVKPFRVLWILV
FT                   VPLGAVSSLDFIWLLADTLNAMMAIPNLIALALLSPVVFSLTREYFIKKREDEAQAKIA
FT                   S"
     atggaaggaa ttactgaatt tgtaagtatg atcaatggct tcgtttgggg tacccccatg        60
     ctggtcatga tcttgggtgt gggtctgttc ctctcggttg gcttgaagtt gatgccaatc       120
     ctgaagctgg gaaccggctt taaactgctc tggtcgggta ggatccccga taaagataag       180
     accatggagg gggagatcag cccctttaac gccttaatga cctccctctc agccactatc       240
     ggtacgggta atatcgcggg tgtggctacc gccatcttta tcggtggacc gggcgcgctg       300
     ttttggatgt ggtgtacggc gctggtcggc atggcaacca agtttgccga ggcggtatta       360
     gcggtgaagt accgtgaagt cgatgataat ggtgaccata ttggtggtcc catgtattac       420
     atcaagaacg gcctcggtag taagtgggcc tggctgggca ctgctttcgc gctatttggc       480
     tcctttgccg gtttcggtat cggtaatacg gtgcagtcaa actcggttgc cgatgcgctg       540
     agcagtaact tcggtgtacc gacttgggcg acgggggtcg ttcttatgat gctggtgggc       600
     gccgtgctta tgggcggtat caagcgtatc gccgatgtgg ctggtaagct ggttcccttg       660
     atgacactgt tttatatcgc tgccggtctg gctgtgttgg ccgttaatgc cgctgcgatt       720
     cccgatgcga tcgttatgat tgttcatagc gcatttaacc cggttgccgc gcagggtggt       780
     tttgccggtg cggcggtttg ggcggcgatc cgcttcggtg tggcgcgtgg tgtgttttca       840
     aacgaagcgg gcctgggtag tgcgccaatt gctcacgcct ctgcgcagac caataatcct       900
     gtggctcagg gcttagtcgc catgttgggc acttttatcg ataccttgat tgtctgtagt       960
     attaccggtc tggcaattat tgtatcgggt gcctggacat ccggtgagaa tggcgctgca      1020
     ttgacttcgc ttgccttctc gacggcgata ccgatgggaa attacatcgt tgctgtagct      1080
     ctgtctgtct ttgctttcac tactatattg ggttggagtg tttacagcga aaagtgtgtg      1140
     cagtatctgt tcggtgttaa agccgttaag cctttcaggg tactctggat attggtggtg      1200
     cctctgggcg ccgtgagttc gctggacttt atctggttac tagccgatac cctgaacgct      1260
     atgatggcca ttcctaacct tatcgctttg gcattgctaa gccctgtggt atttagtctg      1320
     acccgcgagt attttatcaa gaagcgtgaa gatgaagccc aggctaaaat cgcttcgtga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page