(data stored in ACNUC7421 zone)

EMBL: CP000821.PE585

CP000821.PE585       Location/Qualifiers
FT   CDS_pept        complement(714968..715951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0586"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0426 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35198"
FT                   /db_xref="GOA:A8FQS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS5"
FT                   /protein_id="ABV35198.1"
FT                   /translation="MNNKGSSNELAIDARGLTKHFGSLAAVSDMNLSVEKGHIYGFLGP
FT                   NGCGKSTSIRMLTGLLTPTAGSIEVLGMSIPKQAEALRLRIGYMTQKFSLYDDLTVKEN
FT                   LEFIAQIYCLTPNESKRKIGELLSTYKLIKQAKQYAGTLSGGQKQRLSLACSCLNDPEL
FT                   LFLDEPTSAVDPQNRRDFWEQLFDLSESGTSILVTTHYMDEAERCHGLAIMEQGYIRAD
FT                   GSPNELMRQMGAHVIEVSHPNLRQLKSELMLNREIKSAAQLGARLRVLVDNKISDPLGW
FT                   LRQIRPELALNEIREVPPNLEDVFVTVTGQDRDRDSTREPQTSEAN"
     atgaacaaca aaggctcctc gaatgaatta gccatcgacg ccaggggact cactaaacat        60
     ttcggctcgt tagcggcagt ctccgacatg aaccttagcg tcgagaaggg gcatatctat       120
     ggatttctgg gcccaaacgg ctgtggaaaa tccaccagta tccgcatgct gaccggacta       180
     ctcactccca cggcgggaag tattgaggtg ctgggtatgt ctatccctaa acaggccgag       240
     gccctaagac tgcgtatcgg atatatgacg cagaaatttt ctctctatga cgacctgacc       300
     gtcaaagaga acctagagtt tatcgctcaa atctattgct taacccccaa tgagagtaaa       360
     cgaaaaatag gcgaactgct cagcacctat aaactgataa agcaggcgaa acagtatgcc       420
     ggaaccctta gcggtggtca gaagcagcgt ctctccctcg cctgttcatg ccttaacgat       480
     cccgaactcc tctttctcga tgagcccaca tcggcagtgg atcctcaaaa cagacgagac       540
     ttttgggagc agctgttcga cctctctgag agtggcacca gtattctggt caccacccac       600
     tacatggatg aagccgagcg atgccatggg ctcgccatca tggagcaagg gtatattcgc       660
     gccgatggca gccccaacga gctgatgcgg cagatgggcg cccatgttat cgaagtctca       720
     caccctaacc tgagacagct caaatcggag ctgatgctca atagagagat caaatcggcg       780
     gcccaactgg gagcgcgctt aagggtcttg gtagacaaca agatctcaga tcctctgggc       840
     tggctcagac agatccggcc cgaactggcc ctgaacgaaa taagagaggt tccgccaaat       900
     ctggaagatg tatttgtcac cgtcacaggt caggacagag acagagatag cacccgtgag       960
     cctcaaacgt cggaggctaa ttga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page