(data stored in ACNUC7421 zone)

EMBL: CP000821.PE586

CP000821.PE586       Location/Qualifiers
FT   CDS_pept        complement(715948..716892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35199"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS6"
FT                   /protein_id="ABV35199.1"
FT                   /translation="MRPFLSIIFILSLAACQGDVTNQALGTLERDRVLLRATASEIITD
FT                   LPIAEGSMVKKGELLLQFDNNKQLATVAMANAEVQKSQAYLLRLTNGERPEDIASAQAN
FT                   VARTQAALIEAKQSYKRTSSLLKQNLASQAAQDRARANRDQSQAEFNAANENLSKLIAG
FT                   VREEDINQAKAALDAAKAYLSLEKKTLDDLSVIATRDGNLDSLPFNLGERVPPNAVIVA
FT                   IQADNAPYARVYIPETHVAKLTIGQTLTVHVDGVEQVFQGKLRWLSTQPAFTPYYALNQ
FT                   EDRARLVFLAEIDLGSDADRLPTGIPSQVDLPL"
     atgaggcctt ttttatcgat aatctttatc ttaagcctag ccgcttgtca gggagatgtt        60
     acaaaccaag cgctaggaac gttagaacgt gaccgggtat tactcagggc gacggcaagt       120
     gagatcatca ccgacctgcc catagccgaa ggaagcatgg tcaaaaaggg cgaattactg       180
     ttacagtttg ataacaataa acagctggcg actgtagcga tggccaatgc tgaagtccaa       240
     aaatcacaag cctacctgtt aagattaacc aatggtgaac gacccgaaga tattgccagc       300
     gctcaggcaa atgtagcccg aacccaagcc gccctgatag aggccaaaca atcctataaa       360
     agaacatcca gcttattgaa gcaaaatctt gccagccagg cagcacaaga cagagcgaga       420
     gcgaaccgag atcaaagcca ggccgaattt aacgcagcca atgaaaactt aagcaagttg       480
     atcgcgggag tcagagagga agatatcaac caggctaagg cggcgctcga tgctgcaaag       540
     gcctacctgt cgctggaaaa gaagacctta gacgatctca gcgtgatcgc caccagagat       600
     ggaaatctcg atagcctgcc tttcaatctc ggagagcgcg tcccacccaa cgccgtgatt       660
     gtggcgatcc aagccgataa tgccccctat gccagggtct atattcctga gactcatgtt       720
     gccaaactga caataggtca gacacttaca gtccatgtcg atggcgtcga acaggtattt       780
     caaggcaagc tgcgttggct gagtacccag ccagctttta ctccttacta tgcgctgaac       840
     caggaggaca gagcccgact ggtctttctg gccgagatag atctgggcag cgacgcagac       900
     agactgccca cagggatccc ctcccaagtg gacctgccat tatga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page