(data stored in ACNUC7421 zone)

EMBL: CP000821.PE587

CP000821.PE587       Location/Qualifiers
FT   CDS_pept        717378..718286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35200"
FT                   /db_xref="GOA:A8FQS7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS7"
FT                   /protein_id="ABV35200.1"
FT                   /translation="MDIPVWQYVVSMTGYIVFLLVLVEGMRRAPRMTAAFWLLSLLTAP
FT                   LWADNLDGWFRWVKTVSVLIPTAIVVGGARIAWLYHDNPNKFLAFFRGDWVLKVLYMVL
FT                   FLNIAEATAKDFATANYFNAICGVILCITIPFPRYKNGKRLYWVIGRDKPNDLLFYSTA
FT                   AWNFLYTTWNLAFVFGENPGFFASSFCILMAAELYPIIKGRPELYIIARVYTLAFHILV
FT                   RANGDIFTPVMDSSSWASDSVVYYWGAINLAMHIPFVIWYFKTKNKSETNEPPFGEKSP
FT                   PPLISDYSDTKVNDESKLTTA"
     atggacattc ctgtctggca atatgtcgtt tcgatgactg gatatattgt gtttttgctc        60
     gttttggtgg aaggcatgcg ccgtgcacca agaatgacag ccgcattttg gctgctgtcc       120
     cttttaactg cgcctctatg ggcagacaac cttgatggat ggttccgttg ggttaagacg       180
     gtcagcgttc ttatccccac agctattgtc gtaggtggtg ccagaattgc ctggctatac       240
     catgataacc caaacaaatt cctcgcgttt ttccgcggtg actgggtgtt gaaagtgctc       300
     tacatggtac ttttcctcaa tattgctgaa gcgacggcta aagatttcgc caccgccaac       360
     tacttcaacg ctatctgtgg tgtcatctta tgtatcacta ttccgttccc acgttataag       420
     aatggtaagc gtctgtactg ggtgataggc cgtgataagc caaatgacct gctgttctat       480
     tcaactgcgg catggaactt cctctatacc acatggaacc tggcattcgt attcggtgaa       540
     aacccaggct tcttcgccag ctcattctgt atcttgatgg ctgccgagtt gtacccaatc       600
     atcaagggac gcccagagct ttatatcata gctcgagttt acactctggc attccacatt       660
     cttgttcggg caaacggcga catcttcact ccggttatgg actcttcgag ttgggccagc       720
     gatagcgtgg tctactactg gggggcgatt aacctggcta tgcatattcc gttcgttatc       780
     tggtacttca agactaagaa caagagtgaa accaacgaac ctccatttgg agagaagtct       840
     ccaccaccgc tcatctcaga ttattcagac actaaggtga atgacgagag caagctaact       900
     acagcctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page