(data stored in ACNUC7421 zone)

EMBL: CP000821.PE588

CP000821.PE588       Location/Qualifiers
FT   CDS_pept        718427..719533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbo:CBO0434 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35201"
FT                   /db_xref="GOA:A8FQS8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS8"
FT                   /protein_id="ABV35201.1"
FT                   /translation="MAEPAQSQDGGVEKLQGEVWQGTRDGKPGEGSLFYRLEFNADNNV
FT                   EVTKQSGGFNKTETQKWSLNGDSVLIESLNGDEITDFDGASLAFVDSEEIRFSLDGDGF
FT                   NIHKWYKYRAFAHVLFVLIGLMALNELCRRLKWSNYVLWFALPIVLIPLWSSYEITYWF
FT                   KWVKLYSVVGAAALFTLIRFTKVGDMKWAKFGAGAFLAINISEAVMQDFSMGNLANVLN
FT                   AIGGVLSIITLAGWAMIHADKSKQQDMIWPAMTTFWIIAYDVWNIVFVYLNFPGSATAQ
FT                   MMVLIAATLPSLFIKKGTWLQARAFTLAGSFMYYFSCPFMYESNVVPMPRNDELMLAAG
FT                   AASFIINGIYAYVFFSKKFRQRQAVASA"
     atggccgaac ctgcacagag ccaagatggt ggagtcgaaa agcttcaggg cgaggtatgg        60
     caaggtaccc gtgatggtaa acccggcgaa ggtagcctgt tttatcgatt ggagtttaac       120
     gcagataata atgttgaggt taccaagcag tcgggtggct ttaacaagac agagactcag       180
     aagtggagcc tcaatggtga ctcggtatta attgagagtc tcaacggtga tgaaatcacc       240
     gacttcgatg gcgcatcctt ggcgtttgtc gatagtgagg agatacgttt ctccctcgac       300
     ggtgacggct tcaatattca taagtggtac aagtatcgtg catttgcaca cgtcctgttt       360
     gtacttatcg gtttgatggc actgaacgag ctttgtcgcc gcctcaagtg gagtaactat       420
     gtcttatggt tcgctctgcc gattgtattg attccactgt ggtcaagcta tgagatcact       480
     tactggttca aatgggtcaa gctctactcg gttgtcggcg cggcggcact gtttacgctg       540
     atccgtttta ccaaggttgg agatatgaag tgggccaagt ttggtgccgg agccttcctt       600
     gcaatcaaca tctcagaagc ggtaatgcaa gactttagca tgggcaacct agctaacgtt       660
     cttaacgcta tcggtggtgt gctctcaatt atcactctgg caggctgggc aatgatccat       720
     gccgataaga gtaagcagca agatatgatc tggcctgcga tgaccacctt ctggattatc       780
     gcctatgacg tctggaacat cgtatttgtc tacctgaact tcccgggctc agctaccgct       840
     cagatgatgg tattgatcgc ggcgacccta ccttcactct ttattaagaa aggaacctgg       900
     ctacaggcgc gtgcattcac cttagcgggt tcattcatgt actacttcag ttgtccgttt       960
     atgtacgaga gcaacgtagt gcctatgcca cgtaacgatg agctgatgtt ggcggccggt      1020
     gcagccagtt tcatcatcaa cggcatctat gcctacgtct tcttcagtaa gaaattcaga      1080
     cagcgtcagg cggtagccag cgcataa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page