(data stored in ACNUC7421 zone)

EMBL: CP000821.PE589

CP000821.PE589       Location/Qualifiers
FT   CDS_pept        719671..720528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VFA0898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35202"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS9"
FT                   /protein_id="ABV35202.1"
FT                   /translation="MKKRILSIAILASMTSGLTYAADDADIDMSNPTDVYTSIGASYGS
FT                   EGANLKGQLMLSEKTGDTGQKTGIIFEAKNILNEGDKSPQFTGMVQHPDYGMVPTFNDE
FT                   TSKRSYRLRYGTINTTNGTGWSIDAILADHPFYGSMAVVQAGPVMTIPVTDNFYIWPIL
FT                   YAGGVVIEDNMSQILPPDMAGSTVVSSSGIDVPSLILTGMVYARYAFNDNFWALLSTSY
FT                   TEEIQGKSWSDDIMDGGLQMASFSAEISVAYQMNKRQNVRVNYKTDNSDSTDDSYWIEY
FT                   NHAF"
     atgaaaaagc gtattcttag cattgctatt cttgcttcaa tgacatcagg tttaacctat        60
     gcggccgatg acgccgatat cgatatgtcg aacccaaccg acgtatacac ttctatcggt       120
     gcttcatacg gtagtgaagg tgccaacctc aaggggcagt tgatgctgtc tgaaaagaca       180
     ggagatacag gtcagaagac aggcatcatt ttcgaagcca aaaacatcct aaacgaaggg       240
     gataagtctc cacagtttac cggcatggtg cagcatcctg actacggcat ggtgccaacc       300
     tttaacgatg aaaccagcaa gcgttcatac cgtcttcgtt acggcaccat caatactact       360
     aatggtactg gctggtctat cgacgcgatt ctggctgacc atcctttcta cggcagcatg       420
     gccgtcgttc aagccggtcc ggtaatgacg attccagtaa ccgataactt ctatatctgg       480
     cctatcttgt atgcaggtgg tgttgttatt gaagataata tgtcacaaat tcttccacct       540
     gacatggcgg gaagcaccgt agtatcgagt agtggcatcg acgttccttc attgattctg       600
     accggtatgg tctatgcgcg ttatgccttc aacgataact tttgggcact gctaagcact       660
     tcatatacag aggagataca aggtaaatcc tggagcgatg acatcatgga tggcggacta       720
     cagatggcga gcttctccgc tgagatctcg gtggcctacc agatgaacaa gcgtcaaaac       780
     gtacgtgtta actataagac tgataacagc gatagcaccg atgatagcta ctggattgag       840
     tataaccacg cgttctaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page