(data stored in ACNUC7421 zone)

EMBL: CP000821.PE59

CP000821.PE59        Location/Qualifiers
FT   CDS_pept        complement(70710..71627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0059"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: spc:Sputcn32_3458 flagellar hook-associated
FT                   protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34672"
FT                   /db_xref="GOA:A8FP99"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP99"
FT                   /protein_id="ABV34672.1"
FT                   /translation="MRVSTQNMYSSNLYNLQNTTSDLARLNEMMSTGKSLLRPSDDPIG
FT                   SVKVIGSERDMAATNQYLKNIESLSTSFGRAESNLSSMTELQSRMREITVAANNGSLSA
FT                   EDRAAYAAEMNELLDALTDTINAKDEGGNYLFSGNLTDTPPISIDASGNYIYQGDASQR
FT                   EVQVSSSSWMPANVTAQEFIFSNGSTDILNQTKEFIAMLEDPTLSPGDPAFDNVAESML
FT                   TTLDDTLTSISSAMTDIGGKQNSLTLIQGSHEEMVLFNKEVIGETEGLDYAQATAEFNV
FT                   KLTTLKVTQQTFVQVSQLSLFGQM"
     atgcgtgtaa gtactcaaaa catgtacagc agtaacctct acaatctgca aaataccacc        60
     agcgatcttg cccgtctcaa tgagatgatg tcgacaggta aatcactcct tcgcccgtca       120
     gacgatccca taggttcagt caaggtgatc ggcagcgagc gtgatatggc ggcaaccaat       180
     cagtatctca agaatatcga atctctaagt actagcttcg gccgcgcaga gagtaactta       240
     tcgagtatga ccgagctgca gagtcgtatg cgtgaaatca cggtcgcggc caacaacggc       300
     agcctttctg ccgaagacag ggcagcctac gccgcagaga tgaatgagct actcgacgct       360
     ctcaccgaca ccatcaatgc aaaagatgag gggggtaact atctgttttc cggcaacctg       420
     actgataccc cgcccatctc aatcgatgcc agcggtaact atatctatca gggagacgcc       480
     agccaacgtg aagtgcaggt atcaagctcc tcatggatgc ctgccaatgt gacggcccag       540
     gagtttatct tctccaatgg cagcacagat atcctcaacc agacaaaaga gtttatcgct       600
     atgctggaag accccacact atctcccggt gatccggcat tcgataacgt ggccgaaagc       660
     atgctaacga ccttagatga caccttgacc agtatcagta gtgccatgac cgacataggc       720
     ggaaaacaaa acagcttaac tctgatacaa ggttctcacg aagagatggt gctgtttaac       780
     aaggaggtca taggcgaaac agaaggactc gactacgccc aggcaacagc cgagttcaac       840
     gtcaagctca ccacactcaa ggtcacccag caaacgttcg tgcaggtcag ccagctatcg       900
     ctattcgggc agatgtaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page