(data stored in ACNUC7421 zone)

EMBL: CP000821.PE590

CP000821.PE590       Location/Qualifiers
FT   CDS_pept        720630..721193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35203"
FT                   /db_xref="GOA:A8FQT0"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT0"
FT                   /protein_id="ABV35203.1"
FT                   /translation="MIKRALVLGTMLFACGNAVAGSEISGVNLPDSITLQDKVLSFNGA
FT                   GVRSKFFIDLYVGSLFTVGQVDQASKVIDSDQPAAIRLNITSGMITSEKMTDAMNEGFD
FT                   RATDGDSASIADSIKEFIATFEEPIQEGDQFTLLSVPGEGVISYKNGKQLSVTRGETFR
FT                   KAVMAIWLGKNPTDKGLKEDMLEG"
     atgattaaac gtgcactcgt actcggtact atgctatttg cctgtggcaa cgcagtcgct        60
     ggcagcgaga tctccggcgt aaacctaccc gacagcatca ccttgcagga taaggtgctt       120
     agctttaacg gcgcaggcgt tcgcagtaag ttttttatcg acctctatgt gggatctttg       180
     ttcaccgtag gtcaggtcga tcaggcctcg aaggttatcg atagtgatca gcctgcggca       240
     attcgtctga atattacttc gggtatgatc acatctgaga agatgaccga tgccatgaat       300
     gaaggcttcg atcgtgcgac cgatggtgat tctgcttcta ttgcggatag catcaaggag       360
     tttatcgcaa catttgaaga gcctattcag gagggagatc aatttaccct gctgagtgtt       420
     cccggtgaag gggtcatcag ctataaaaat ggcaagcagt tgtctgtaac tcgtggtgaa       480
     accttccgta aggccgtgat ggccatctgg ttaggtaaga acccgacaga taaaggcctg       540
     aaagaggata tgcttgaagg ctaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page