(data stored in ACNUC7421 zone)

EMBL: CP000821.PE591

CP000821.PE591       Location/Qualifiers
FT   CDS_pept        721346..722806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0592"
FT                   /product="conserved hypothetical methyl-accepting
FT                   chemotaxis protein"
FT                   /note="KEGG: ppr:PBPRA1115 hypothetical methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35204"
FT                   /db_xref="GOA:A8FQT1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT1"
FT                   /protein_id="ABV35204.1"
FT                   /translation="MTPLAIWRAMFMPESHQWRPEQLRFVDTLMFFTLLSLFTGLYSLF
FT                   KWLQHDHTLLIYTSFLLIGAELLAGAIVRFGRMPVLALNVGFFGMVVHALNMIYQGGGV
FT                   LSSTQTLWIPVLIISFFLTANLLMATLWSLGVILFSSRMVANALNGVAMPQMELSPSAL
FT                   ATETWSGLIMPLLVIVVAQGFTAKQRNKAMNAAERAQFDTLATAEKAQQGELQLSEVLD
FT                   KAGDNAGQLSLVANELESQSLDLHQQVNNLNQNCESQASAAEQMSQQLLRMTSDMEQSE
FT                   RFVTEMRERSEVINRQAQSSAESLAASTDAIDKILISNEKIMSVAGLITSVADQTNLLA
FT                   LNAAIEAARAGEHGRGFAVVAEQVRELSAKSNASAVEIRALLDLSKQEVNHGQVVIQAT
FT                   ANELSGIIEQVSETVTDVNQLADTMVHQVQAVQELNSASAEVANSVVQTNQVSESVATQ
FT                   GKQLTQQVDTLKALAEDLRLAMLSKSAA"
     atgacgccac tggcaatctg gcgggcgatg tttatgcctg aatcccatca atggcgaccg        60
     gagcagttac gcttcgtcga taccttgatg ttctttacct tgctctctct ttttaccggt       120
     ctttatagcc tcttcaaatg gctgcaacac gatcacactc tccttattta tacctcattt       180
     cttcttatcg gcgccgagct gttagccggg gcgatagtgc gttttggccg tatgccggtg       240
     ttggccctca acgtcggatt ttttggcatg gtcgtgcatg cgctgaatat gatctatcag       300
     ggtggagggg tattgagttc gactcagacc ctgtggattc cggtgttaat catctccttc       360
     ttcctcaccg ctaatctctt gatggcaacg ctctggagtc ttggtgtaat tctcttctca       420
     tccaggatgg tggcgaatgc actgaacggc gtagctatgc cacagatgga gctttcaccc       480
     tcggcgctgg caaccgagac ctggtcgggt ttgataatgc cactgctggt gatcgtggtc       540
     gctcagggct ttaccgctaa gcagcgcaac aaggcgatga acgccgcaga gagggctcag       600
     tttgatacct tagccacggc agaaaaggca cagcagggag agttgcaact atctgaagta       660
     ttagacaagg cgggtgataa tgcaggtcaa ctctctttgg tggccaatga gctcgagagt       720
     cagtctttag atctgcatca acaggtcaac aatctcaatc aaaattgtga atcccaggcg       780
     agtgcggccg aacagatgag ccagcagctt ctgaggatga catcggatat ggagcaatct       840
     gagcgcttcg tgactgagat gagagagcgc agcgaggtga ttaacagaca agcacagagc       900
     agtgccgaat ccttggcggc ttcaacggat gcgatcgata aaattttaat cagtaatgaa       960
     aaaatcatgt cggtagcggg cttgatcact tctgtggcgg atcagactaa cctgctggcc      1020
     ctgaatgcgg cgatcgaagc cgccagggcc ggggagcacg gtcgagggtt tgcggtcgtc      1080
     gccgaacagg ttcgtgaact gtcggcaaag agtaatgcct cggcagtgga aataagggcc      1140
     ctgctggatc tcagtaaaca ggaggtcaac catggtcagg tggtgataca agcgacggcc      1200
     aatgagctgt ccggcattat cgaacaggtc agcgagaccg tcacagatgt caatcagttg      1260
     gccgatacca tggtgcatca ggttcaggcg gtgcaggagt taaactcggc cagcgccgag      1320
     gtggcaaaca gtgtggtgca gaccaatcag gtatctgagt cggtagcgac acaaggcaaa      1380
     cagctgacgc aacaggtcga tactctaaag gcccttgccg aggatctcag gctcgccatg      1440
     ttatcaaaga gtgctgcata g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page