(data stored in ACNUC7421 zone)

EMBL: CP000821.PE593

CP000821.PE593       Location/Qualifiers
FT   CDS_pept        724186..725883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0594"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="KEGG: maq:Maqu_1346 FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35206"
FT                   /db_xref="GOA:A8FQT3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT3"
FT                   /protein_id="ABV35206.1"
FT                   /translation="MQPERRNMNRSQQDNRNWNGWGAREKRMELSQDGAAFICEKLGQA
FT                   KPLGVSTLARVIAKVPDSRLADSELYSTDAEIRLRHARGQSLPDWLAMKSGEFGVFPDA
FT                   VAFPVSGEDIRILMAEAKANGWQLIPYGGGTSVVGHITPCPSDKPVITVSLTKMNRLLE
FT                   LDRVDQIATFGAGVKGPFLEAQLQAHGYTLGHFPQSFELSTLGGWVVTRSSGQQSLGYG
FT                   RIENLFAGGEIETFNGTVDIPTLPASSAGPDWRQLVLGSEGHLGILTQAKVRVTRVAEE
FT                   EFFGVAFMPDWQSGIDCAREIIQQKLPLSMLRVSNSEETHTQLFLSATETQRSWLNRLL
FT                   SLKGVGEGKCMLVYGVTGDLDANRQSYKRLKQVLRRFKGVNTGQRLGKKWAHKRFTFPY
FT                   LRETLWQMGYAIDTLETATNWSNIESMTQKIEHSLRDGLTEFDSKVHVFSHLSHLYGDG
FT                   ASIYTTYLFPVADSYDETYRRWQKLKSTTSTLIVENNGTISHQHGVGSDHAPYLAREKG
FT                   EHVMASLQTCFDYFDPDKQLNPGKLFKAGQTEPVETVHTEKSHTEKEQ"
     atgcaaccgg aacggcgaaa tatgaacaga tcacagcaag ataatcgaaa ctggaatggt        60
     tggggcgcca gagagaaacg gatggagctt tcacaagatg gtgcagcttt tatctgtgaa       120
     aaactgggcc aggccaagcc attgggagta tcgacactgg cgcgggtgat tgccaaggtt       180
     cccgattcca gacttgccga tagcgagcta tattcgaccg acgcagagat caggctacgc       240
     cacgcccggg ggcagagcct acccgattgg ctggcaatga agagtggcga gtttggcgtc       300
     tttcccgatg ccgtcgcgtt tcctgtatcc ggtgaagata ttcgcatctt gatggcggag       360
     gctaaagcga atggctggca gcttattccc tatgggggtg gcacatctgt agtgggccat       420
     attacgccat gtccgtcaga taaacccgtt atcaccgtct ctctgactaa gatgaatcgg       480
     ctcctcgagc tggacagggt cgatcagatt gccaccttcg gcgccggggt aaaggggcct       540
     ttcctcgagg ctcaacttca ggcacatggc tatactctgg gccattttcc tcaatctttc       600
     gagctctcta cattgggcgg ctgggtggta acgcgctcca gtggacagca atcattgggt       660
     tatggtcgta tcgaaaacct gtttgcaggt ggagagatag aaacctttaa tggcacggtg       720
     gatatcccaa ccttgcctgc atcatcggcg ggaccggact ggcgccagtt ggtactggga       780
     tcggaagggc acttggggat cttgactcag gctaaggtga gggtcacccg tgtcgccgaa       840
     gaggaatttt ttggtgtcgc cttcatgcct gactggcaga gtgggatcga ctgcgccagg       900
     gagatcattc agcaaaagct tcccctctct atgctgcggg tcagcaacag tgaagagacc       960
     catacccagc tatttctttc ggcgacagag actcagcgca gctggttgaa tcgtctgctt      1020
     tcactcaagg gagtaggtga agggaaatgt atgctggtct atggcgtcac gggagacctg      1080
     gatgccaaca ggcaaagcta taagcgactc aagcaggttt tacgtcgctt caaaggggtt      1140
     aataccgggc agcgcctggg caagaagtgg gcccataaac gatttacctt cccctacctg      1200
     agagaaacgc tgtggcagat gggctatgcg atcgatactt tagagacggc gacaaactgg      1260
     tcgaatatcg aatcaatgac gcaaaagata gagcacagtc tgcgagatgg gttaactgag      1320
     tttgattcca aggtacatgt attctcgcat ctgtctcatc tctatggtga tggtgccagt      1380
     atctatacca catacctctt tcctgtcgcg gatagctatg atgaaaccta tcgtcgctgg      1440
     cagaaactaa aatctacgac atcgaccttg atcgtggaaa ataatggcac cattagccat      1500
     cagcatggcg tcggcagtga tcatgccccg tatctagcca gggaaaaagg tgagcatgtg      1560
     atggcatccc tgcagacctg tttcgactac ttcgatccgg acaaacagtt aaatccgggt      1620
     aagctgttta aggcggggca gacagaacct gtagagactg ttcacactga gaaaagtcac      1680
     acagagaaag agcaatga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page