(data stored in ACNUC7421 zone)

EMBL: CP000821.PE6

CP000821.PE6         Location/Qualifiers
FT   CDS_pept        4812..6200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0006"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shm:Shewmr7_0001 chromosomal replication
FT                   initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34619"
FT                   /db_xref="GOA:A8FP46"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP46"
FT                   /protein_id="ABV34619.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAQMDGDTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGSDAPKLRFDIGSRPSAPRPVQATAAVERPKFEQNTK
FT                   PAKTSFNVNSPEPAMAANHRSNINRTYQFENFVEGKSNQLGKAAAMQVAENPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVA
FT                   RPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDTKEDYANLIR
FT                   TLSS"
     gtggcggttt cactttggca gcaatgtatc ggacgactac aagatgagct ctctgctcag        60
     caattcagta tgtggattag accgttacaa gctcaaatgg atggagatac attagttctc       120
     tatgctccaa accgtttcgt tctcgattgg gtaagagata agtacatcaa catcatcaat       180
     cagtttttta ctgaacagat gggaagtgat gcacctaagt tacgcttcga tatcgggagt       240
     cgcccttcag cgccacgacc tgtgcaggca actgctgcgg tagaaaggcc caagttcgag       300
     caaaatacta aaccggctaa gacttcattt aatgtcaatt cgccagagcc agctatggcc       360
     gcgaatcaca gaagcaatat caatcggact tatcagtttg aaaacttcgt agaaggtaag       420
     tctaaccaac tgggtaaggc ggctgcgatg caagtggctg aaaatccggg tggcgcttat       480
     aatccactct tcttgtatgg tggtaccggt ttaggtaaga cccatctgtt acatgctgtg       540
     ggtaatggca ttataaagaa caatcctaat gctaaagtcg tgtatatgca ttctgagcgc       600
     ttcgttcaag atatggttaa ggcattacag aataacgcga tcgaagaatt caaacgttac       660
     taccgtagcg tcgatgcttt atttatcgat gatattcaat tctttgctaa caaagacaga       720
     tcccaggaag aatttttcca tacctttaat gcactattgg aaggtaatca tcagatcatc       780
     ttaacgtcgg acaaatatcc taaagagatc gacggcgttg aagacagact taaatctcgc       840
     ttcggttggg gccttacggt tgcgatcgag ccgccagagt tagagacccg agtggctatt       900
     ttgatgcgta aggctcagga gagcggcatt aatctgcccg atgaagtggc cttctttatt       960
     gccaagcgtt tacgttctaa cgttcgagag cttgaaggtg cattgaatcg tgttattgcg      1020
     aacgctaact ttaccggacg tccgattact atcgactttg tgcgtgaagc cttaagagac      1080
     ctcttggcac tgcaggaaaa attggtcact atagataaca ttcagaaaac cgtcgctgaa      1140
     tattacaaga tcaagatggc tgacatgctt tctaagcgtc gttcgcgtag tgttgccaga      1200
     ccacgccagg tggctatggc actttctaaa gagttaacca accatagttt gcccgaaata      1260
     ggggatgcct ttggtggccg agaccataca actgttctgc acgcttgtcg taaaattgca      1320
     cagttgagag aagaaagtca tgacacgaaa gaagattatg ctaacttgat ccgtacgcta      1380
     tcttcataa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page