(data stored in ACNUC7421 zone)

EMBL: CP000821.PE60

CP000821.PE60        Location/Qualifiers
FT   CDS_pept        complement(71640..73013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0060"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="KEGG: spc:Sputcn32_3459 flagellar hook-associated
FT                   protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34673"
FT                   /db_xref="GOA:A8FPA0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA0"
FT                   /protein_id="ABV34673.1"
FT                   /translation="MSMLNIGMSGLNASMAALNTTSNNVANAMVPGYSRQQVMMSSVGS
FT                   GTYGGGAGVMVDGVRRISDQYEVAQLWNTTSDVGFSKVQASYYGQVEQIFGSDGNNISQ
FT                   GLDLLFASLNSAMEQPNEIAYRQGVLNEARALTHRFNSISEGVNAQLSQIEGQLGASVK
FT                   EVNAQLQTIASFNAEIQASGNNGNVPSSLLDARDAAVDDLAAIVDINVVEDSNGMLNIS
FT                   LAQGQPLLAGTTASTLSVSPDPGNPGMSKISIQFGQSSFPVDESAGGSLGALLDYRDNS
FT                   LMDSIAFIDELAMTIADEFNAVLAGGTDLNGNTPTQDLFTYDPNSPAGSLKLTSGFTAE
FT                   MLAFGQDGTPGDNSNLKELVELANKSFTFNSIGADTTMGDAFASKIGELGSASRQAQVN
FT                   ADTSVKLQMEAQSQWASTSGVNMDEEAVNLIIYQQSYQANAKVISTADQLFQTILNSI"
     atgagcatgc taaatattgg tatgtctggg ctgaatgcga gtatggcagc cctgaatacg        60
     acctcaaaca atgttgccaa tgctatggtg cctggttatt cacgccaaca ggtgatgatg       120
     agctctgtcg gcagcggaac ctatggtggt ggcgcagggg tcatggttga tggcgtgcga       180
     cgtatttcgg accagtatga ggtggctcag ttgtggaata ccaccagcga tgtaggcttc       240
     agcaaggtac aggccagtta ttatggtcag gttgagcaaa tttttggctc cgatggtaac       300
     aacatctctc aaggtctgga tctgcttttc gcttcgctga actcggccat ggagcaaccc       360
     aatgagatag cctatcgcca aggcgtattg aatgaagcaa gggcattaac tcacaggttt       420
     aactccatca gcgagggggt caatgcacaa ttatctcaga tcgagggaca gctaggcgcc       480
     tcggttaaag aggtgaatgc tcaactacag accatagcca gcttcaatgc cgaaatccag       540
     gcatccggca acaatggcaa tgtgccctca tctttgttag atgcccgcga tgccgccgtc       600
     gatgacttgg ccgccattgt cgatatcaat gtggtcgaag actctaatgg catgctcaac       660
     atctctctgg cacagggaca acctctgctg gcaggaacca cggcttcgac tttgagtgtc       720
     tcacccgatc caggcaaccc gggaatgagt aagatcagca ttcaatttgg ccagtcgagc       780
     tttcctgtag atgaaagtgc aggagggagc ttaggtgccc tgctcgatta tcgcgataac       840
     agcttgatgg actcgatagc ctttatcgac gagttagcca tgaccatagc cgatgagttc       900
     aatgccgtac tggcgggagg cacagatctt aacggcaata caccgacaca agacctgttt       960
     acctacgatc cgaacagccc agccggcagt ctcaagttga cctcaggatt taccgccgaa      1020
     atgctggcat tcggccagga tggtactccg ggtgataaca gtaacctcaa agagttggtc      1080
     gagctggcca ataaaagctt caccttcaac tcaatcggcg cagacacgac tatgggggat      1140
     gccttcgcca gcaagatagg tgaactgggc tccgcatctc gtcaggcaca ggtaaacgcc      1200
     gacaccagcg tgaagttaca gatggaggct cagtctcagt gggcaagcac cagcggcgtc      1260
     aatatggatg aagaggcggt aaacctgatc atctatcagc aatcctatca ggcaaatgcc      1320
     aaggtgatat cgactgccga ccaactattc caaaccattc tcaacagcat ttaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page