(data stored in ACNUC7421 zone)

EMBL: CP000821.PE61

CP000821.PE61        Location/Qualifiers
FT   CDS_pept        complement(73080..73517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34674"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA1"
FT                   /protein_id="ABV34674.1"
FT                   /translation="MKLDNVQNSHGYLKQMNAGDLIKANGEYGALELVSQQFEAQFLQT
FT                   VLKQMRSASDVMADKDNPLSSQNDGMYRDWHDAELAGRLSQMQSTGLASVMTKQLAGAL
FT                   KSAPQPVASTNQVAEEMSVNPSNTTAMQPALIVPMMAKPSE"
     atgaaattag acaacgtgca aaactcccat gggtatctga aacagatgaa cgccggcgac        60
     ctgataaagg ccaatggtga atatggtgca ctcgaactgg tgagtcagca gtttgaggcg       120
     caattcttac aaacggtact gaagcagatg cgcagcgcct ccgatgtgat ggccgataaa       180
     gataacccgc tctcatcgca aaatgatggc atgtaccgcg actggcacga tgcagagttg       240
     gctggacgcc tgagtcagat gcagagcaca gggcttgcca gtgtgatgac caaacaattg       300
     gctggtgcac ttaagtccgc ccctcagcct gtcgcctcta ctaatcaggt agccgaagaa       360
     atgtcggtga acccgagcaa cacgacagcc atgcaacccg cactcatagt gccgatgatg       420
     gccaagccaa gcgagtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page