(data stored in ACNUC7421 zone)

EMBL: CP000821.PE62

CP000821.PE62        Location/Qualifiers
FT   CDS_pept        complement(73517..74644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0062"
FT                   /product="flagellar P-ring protein"
FT                   /note="KEGG: spc:Sputcn32_3461 flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34675"
FT                   /db_xref="GOA:A8FPA2"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA2"
FT                   /protein_id="ABV34675.1"
FT                   /translation="MKKPLILIMSLLLIFTVDSVSAQSQTRYLMDIVDVQGIRENQLVG
FT                   YGLVVGLDGTGDRTQVRFTSQSVVNMLKQFGVQIDDKTDPKLKNVAAVAVHGNVPALAS
FT                   PGQSIDITVSSLGDAKSLRGGTLLMTPLRAVDGEIYAVAQGNLVVGGVSAQGRNGTSVT
FT                   INVPTVGNIPNGALLEAPMHSNFTESETIVLNLRAPSFMTARNIERTVNALFGPDVAQA
FT                   DSNAKVTVRAPESKRERVTFMSMLEELQIEQGRKSPRVVFNSRTGTVVMGGDVVVRKAA
FT                   VSHGNLTVTIIEKESVSQPNGALWGQAQGETVVTTDSQVDIDTGNGHMFVWPEGIALEE
FT                   VVRAVNSLGASPMDLMAILQALDEAGALEAELVVI"
     atgaaaaagc ccctaatttt gatcatgagc ctactgctca tttttaccgt ggatagcgta        60
     tcggctcaaa gccagactcg ttacttgatg gatatcgtcg acgtgcaggg gatccgggaa       120
     aaccaacttg tcggctacgg tttagtcgtc gggttagacg gtacggggga tcgaactcag       180
     gtgagattca ccagtcagtc cgtcgttaat atgctgaaac agttcggtgt tcagatagat       240
     gacaaaacgg accccaagct caagaacgtt gcggcagtgg ccgtacacgg aaacgtacca       300
     gcactcgcca gtccgggtca gagcatagat atcacggtat cctctctggg tgatgcaaaa       360
     agcctgcgtg gcggcaccct gctgatgacc cctcttcgcg ccgtagatgg cgagatctat       420
     gcggtagcac agggtaactt agtcgtcggt ggcgtttcgg ctcagggacg taacggcacc       480
     tctgtgacca tcaacgtacc taccgttggc aatatcccca atggcgcact gctcgaagcg       540
     cccatgcaca gtaacttcac cgagtcagag acgatagtcc tcaacctgcg tgcccccagc       600
     tttatgacgg cgcgaaacat tgaacgcacc gttaatgcgt tatttggtcc cgatgttgct       660
     caggccgaca gcaatgccaa ggttaccgtc cgggctccgg agtcgaagcg ggaaagggtc       720
     acctttatgt ccatgctcga ggagttacag atagagcagg gacgaaaatc accacgagtc       780
     gtcttcaata gtcgcaccgg aacagttgtc atgggtggag atgtggtggt gagaaaagcc       840
     gccgtcagcc atgggaacct gaccgtcacc atcatagaga aagagagtgt cagtcagcct       900
     aacggagcgc tctggggaca agcccagggc gaaaccgtcg tcaccacaga tagtcaagtc       960
     gatatcgaca cgggtaacgg ccacatgttt gtctggcctg aagggatagc gctggaggag      1020
     gtcgtcaggg ccgtcaacag tctgggggca tcacccatgg atctgatggc gatactccag      1080
     gcactggatg aagccggagc actcgaagcc gaattggtgg tgatctga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page