(data stored in ACNUC7421 zone)

EMBL: CP000821.PE63

CP000821.PE63        Location/Qualifiers
FT   CDS_pept        complement(74739..75401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0063"
FT                   /product="flagellar L-ring protein"
FT                   /note="KEGG: spc:Sputcn32_3462 flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34676"
FT                   /db_xref="GOA:A8FPA3"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA3"
FT                   /protein_id="ABV34676.1"
FT                   /translation="MRHLWIGMLLLLSGCAANFPEADTKPGQPEWAPPEIDYSLPDAKD
FT                   GSAYRQGYMLTLFKDKRAFREGDILTVALDEKTYSSKRADTKANKEQDLSIGAQASAGD
FT                   SSYSGAGDGSLARGFKGSGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDE
FT                   YLRLLGLIRTDDIGNDNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL"
     atgcgtcatt tatggatagg aatgctgttg ctgttatctg gatgtgcggc caactttccc        60
     gaagccgaca ctaagcccgg tcaaccggag tgggcaccac cggagataga ctacagcctg       120
     ccggatgcga aggatggcag cgcatatcgt cagggataca tgttaaccct gtttaaagat       180
     aagcgcgcct ttcgggaggg agatattctc actgtcgcgc tggacgagaa aacctactcc       240
     agtaaacgag ccgacacgaa agccaataag gagcaggatc tctcaatcgg agctcaggcc       300
     tcggcgggtg actccagcta tagcggcgcc ggtgacggct cattggcgcg agggtttaag       360
     ggctcaggct ccagtaccca acaaaaccaa ctctccggct caattacagt caccgtggct       420
     aaggtactgc caaatggggc cttgcttatc cggggggaga aatggttgag actcaaccag       480
     ggggatgaat atttacgcct gctcggattg atccgtaccg atgatattgg caatgacaat       540
     accatctcat ctcagaggat cgccgacgcc cgcatcatct acggtggtca gggtgccatt       600
     gcagacagca atgccatggg gtgggcatca cggtacttta acagcccctg gttcccccta       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page