(data stored in ACNUC7421 zone)

EMBL: CP000821.PE64

CP000821.PE64        Location/Qualifiers
FT   CDS_pept        complement(75446..76231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0064"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="KEGG: spc:Sputcn32_3463 flagellar basal-body rod
FT                   protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34677"
FT                   /db_xref="GOA:A8FPA4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA4"
FT                   /protein_id="ABV34677.1"
FT                   /translation="MQSALWVSKTGLTAQDVKMTTIANNLANVNTTGFKRDRVAFNDLF
FT                   YQTQRQPGGQVDELNELPSGLQLGTGTRVVGTQKIFTSGDMLTTNQQLDLAIEGQGFFQ
FT                   IEEANGDLAYSRDGQFYRNSDGLMVTSQGLPLVPNIEIPEDALTITIATDGIVTAQISG
FT                   QAEAQELGQITLVNFTNPTGLEARGDNLYRETGASGAAIEGVAGDQAIGQLRQGALEGA
FT                   NVNVVEEMVEMISTQRAYEMNAKVVSASDDMLKFLNQSL"
     atgcaatcag cattatgggt cagtaagacc gggttaacag cccaagatgt aaaaatgacc        60
     acgatagcca acaatctggc taacgtgaat acaaccggct ttaagcgtga cagagtcgcg       120
     tttaatgacc tgttttatca gactcagcgc caacccggcg ggcaggtcga tgagctcaat       180
     gaacttccat ccgggctgca gctgggcacg ggaacacgag tcgtcggaac ccaaaagatc       240
     tttaccagcg gtgacatgct caccacgaac cagcagttag atctggccat cgaagggcaa       300
     ggcttctttc agatagagga agccaatggc gatctggcct acagccggga cgggcaattt       360
     tatcgtaata gcgatggtct gatggtgacc tctcaaggac tgcctctggt accgaatatc       420
     gagatcccgg aagatgcact caccatcact atcgcgacag acggtatcgt cacggcgcag       480
     atctccggcc aagcagaggc tcaggaactg ggccaaatca ccttagtgaa ctttaccaat       540
     cctaccgggc tggaagccag aggcgacaac ctctatcgcg aaaccggcgc atccggagcc       600
     gccatagagg gcgttgccgg cgatcaggct atcggccaac ttcgccaggg cgcattggag       660
     ggagcgaacg taaatgtggt cgaggagatg gtcgaaatga tctccactca aagagcctac       720
     gagatgaatg ccaaggtcgt ttcggcatcc gatgacatgc tcaagttcct caaccagtcg       780
     ctgtag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page