(data stored in ACNUC7421 zone)

EMBL: CP000821.PE65

CP000821.PE65        Location/Qualifiers
FT   CDS_pept        complement(76302..77036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0065"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="KEGG: shw:Sputw3181_0475 flagellar basal-body rod
FT                   protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34678"
FT                   /db_xref="GOA:A8FPA5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA5"
FT                   /protein_id="ABV34678.1"
FT                   /translation="MDKMLYTAAAGAARVMEAQAIRANNLANAETTGFKADLERVNATV
FT                   IPAMGNTLQTRVMAQTQSSGFSHQSGALNPTGRTLDLAIREQGLFSVMTEQGEAYTRSG
FT                   TLVPDTNGQLTIDGRPVAGIDGPIVLPEYRELFVGDDGRISVLAAEGGITEEVGQLKLV
FT                   NPELDTMEKGLDGLFYSRDGQPLQANEQVKVDSGFLESSNVKAVSELIASMDLSRQFEV
FT                   QVKLMKSAEKLAEAGNRLLRNA"
     atggacaaaa tgctttatac cgcagcagcg ggggcggctc gggtgatgga ggctcaggcc        60
     atcagggcca ataacttagc caatgccgaa accacaggct tcaaggccga tctggagcgg       120
     gtaaatgcca ccgtcatccc cgccatgggg aacactttac agactcgcgt gatggcgcag       180
     acccagagca gtggtttcag ccaccaaagt ggtgccctga atcctacggg gagaacgctg       240
     gatctggcta ttcgtgagca gggtctgttc agcgtaatga ccgagcaagg cgaagcctac       300
     acccgctcgg gcactctggt ccccgatact aatggacagt tgaccataga cgggcgtccc       360
     gtggccggta tagatggccc tatcgtattg ccggagtatc gcgaactatt cgtgggtgac       420
     gatggccgaa tcagcgtgct ggcggccgag ggcggcatta ccgaggaggt gggacagctc       480
     aaactggtta acccggagct cgacaccatg gagaaaggtt tagatggcct gttttacagc       540
     cgtgatggcc agccgctaca ggccaatgaa caggtaaaag tcgacagcgg ttttctggag       600
     tccagtaacg tcaaggcggt cagtgagctg atcgcctcca tggatctcag tcgtcagttt       660
     gaggtgcagg taaaactcat gaaaagtgca gagaagttag ccgaagctgg taacagactg       720
     cttagaaacg cttaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page