(data stored in ACNUC7421 zone)

EMBL: CP000821.PE67

CP000821.PE67        Location/Qualifiers
FT   CDS_pept        complement(78272..78937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0067"
FT                   /product="flagellar hook capping protein"
FT                   /note="KEGG: shw:Sputw3181_0473 flagellar hook capping
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34680"
FT                   /db_xref="GOA:A8FPA7"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA7"
FT                   /protein_id="ABV34680.1"
FT                   /translation="MNVNSTTNSSGNDNTSDVMNSPGNDAASIKNEFMTLMIAQIQNQD
FT                   PTNPIDSTEYVTQLAQFSQVESLEQMRLNQSTQMVMMENLGIVQSAQLIGKDAMVPASE
FT                   VTLDTETVHGKVYTGNAVEELSIDIMDESGEVVSTLKLGPQEVGDIEFSIDPEALGLPP
FT                   GKYSIEAQATSGEETLTADTFIQAPIEKIHFVSASGMMMAELGYGLGTVSVLDISEVS"
     atgaatgtaa acagtaccac caacagtagt ggcaacgata acaccagtga tgtgatgaac        60
     tcgccgggta acgatgcggc gtccatcaag aatgagttta tgaccttgat gatcgcgcag       120
     atccaaaacc aggacccgac aaaccctatc gacagcaccg agtatgtcac tcagttagcc       180
     caattctctc aggttgagag cttagagcag atgcgcctga accagtcgac tcagatggtc       240
     atgatggaga acctgggcat agtccaatcg gcgcagttga tcggtaaaga tgccatggtc       300
     ccggcttccg aggtgacctt agatacagaa accgttcacg gcaaagtcta tacaggcaac       360
     gcagtcgaag agctcagtat cgacatcatg gatgagagcg gcgaagtggt atcgaccctg       420
     aagctgggtc cacaggaggt cggtgatatc gaattttcca tagatccaga agccctaggt       480
     cttccgccgg gcaaatacag catagaagcc caggccacct cgggcgaaga aacgctgacc       540
     gcagatacct tcattcaggc gccgattgag aagatccact tcgtcagcgc ctcaggaatg       600
     atgatggccg agcttggcta cggcctgggc acggtatcag ttctggatat ctctgaagtc       660
     tcataa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page