(data stored in ACNUC7421 zone)

EMBL: CP000821.PE68

CP000821.PE68        Location/Qualifiers
FT   CDS_pept        complement(79003..79422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0068"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="KEGG: shw:Sputw3181_0472 flagellar basal-body rod
FT                   protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34681"
FT                   /db_xref="GOA:A8FPA8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA8"
FT                   /protein_id="ABV34681.1"
FT                   /translation="MSFGEIYQIAGAGMHAQSIRLNTVASNLANAGAAAETQDSAYRAL
FT                   KPVFSTIYNQTQAGEVSGAQVEVAAIVETDAPLDMRYEPDHPFADEQGYVAYSNVNTVE
FT                   EMADMMAASRSFETSVEVMNQARSMQQGLLQLGTK"
     atgtcttttg gagagatcta tcaaatagcg ggagccggca tgcatgccca gagcattcgc        60
     ctcaataccg tggccagcaa cctggccaat gctggcgcgg cggcagagac tcaagatagt       120
     gcttacagag cattaaagcc ggtattttcc accatctata accagacgca agccggcgag       180
     gtctccggcg cacaggtaga ggtcgccgcc atagttgaaa ccgatgcacc actagatatg       240
     cgctacgaac ctgatcatcc ttttgccgat gaacagggtt atgtcgccta ctccaacgtc       300
     aacaccgtcg aggagatggc agacatgatg gcggcgagtc gctcatttga aaccagtgtc       360
     gaagtgatga accaggcgcg ctccatgcaa caaggtctcc tgcagctggg caccaagtaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page