(data stored in ACNUC7421 zone)

EMBL: CP000821.PE69

CP000821.PE69        Location/Qualifiers
FT   CDS_pept        complement(79521..79871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0069"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="KEGG: shw:Sputw3181_0471 flagellar basal-body rod
FT                   protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34682"
FT                   /db_xref="GOA:A8FPA9"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA9"
FT                   /protein_id="ABV34682.1"
FT                   /translation="MAINLDAALGIHPQTLDFRVERTKILAGNLANAETPGYKAKDLNF
FT                   QALMSGINAGMPASNQYEVGYRVPYQTSADQNTVELGKEQARYSQNAMDYQTSLTFLNM
FT                   KISGLKSAIEGQ"
     atggctatca acctcgatgc cgcactgggt attcatcccc aaacgctcga ttttagagtc        60
     gaacgaacca agatactagc aggcaatctg gcaaatgccg agacccctgg ttataaagct       120
     aaagatctta attttcaagc actcatgtca ggtattaacg ccggtatgcc cgccagcaat       180
     caatatgaag tgggttaccg ggtgccgtat cagacctctg ccgaccaaaa cacggtcgaa       240
     ctaggcaagg agcaggcaag gtactcacaa aatgcgatgg attaccaaac cagcctgacc       300
     tttctcaaca tgaagatttc gggactcaag tcagccatcg aagggcaata g                351
//

If you have problems or comments...

PBIL Back to PBIL home page