(data stored in ACNUC7421 zone)

EMBL: CP000821.PE7

CP000821.PE7         Location/Qualifiers
FT   CDS_pept        6220..7320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0007"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: slo:Shew_0002 DNA polymerase III, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34620"
FT                   /db_xref="GOA:A8FP47"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP47"
FT                   /protein_id="ABV34620.1"
FT                   /translation="MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVEVSGHSLKMT
FT                   GTDLEVELVGQVQLEGDVQEGRTTIPAKKFLDIVKSLPDQVELKIEQQENRLLLRSGRS
FT                   RFTLATLPAEEYPNVEAFQADIEFTIKQGTLKSLIDATQFSMANQDVRYYLNGLLLETE
FT                   GNVLRAIATDGHRLALSHRMVEESLPEKQVIVPRKGVVELQRLFEGEDLDITIAIGDNA
FT                   IRATTGSAVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALLRASILSNEKFRGV
FT                   RVQLENNLIKITANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPSDDVRITL
FT                   IDGNSSALIENHIEENSMYVVMPMRL"
     atgaaatttt caattgatag ggatgcccta ttaaagccgt tgcaacttgt gaccggagcg        60
     gtggagagac gacataactt gccaatactg gcaaacctct tagttgaagt gagtggtcac       120
     tcacttaaga tgaccggtac cgatttagaa gtcgaattgg tggggcaggt tcagttagag       180
     ggtgacgtac aggaaggacg taccacgata ccggcgaaaa aatttctcga tattgttaaa       240
     tcattacccg atcaggtaga gcttaaaatc gagcaacagg aaaatcgcct gttactccgc       300
     tctggtcgta gtcgttttac tctggcaaca ctccctgccg aagaatatcc gaatgtggag       360
     gccttccagg ccgatatcga atttacgata aagcaaggca cactcaagtc actcatcgat       420
     gcgactcagt tctcgatggc taatcaggat gtccgttatt atcttaacgg tttgttgtta       480
     gagaccgaag gaaatgtgct gcgtgctatc gctaccgatg gtcatcgctt agcattgagc       540
     catcgtatgg ttgaagaatc actgcctgag aagcaggtga tcgtgccgcg taaaggtgtg       600
     gtcgagttgc aacgcttatt cgaaggcgaa gatttagata tcactatcgc tatcggcgat       660
     aatgccattc gtgcgacgac ggggagtgct gtattcacca gtaagctggt cgatggtcgc       720
     ttccctgatt accgtcgtgt attgcctaaa ggtggcgata agatcgttat tgcgagtcgt       780
     aaccatctta aacaggcgct attgcgtgct tctattcttt caaatgaaaa attccgtggc       840
     gtacgtgttc agcttgaaaa taatctgata aagatcaccg ccaataatcc ggagcaggaa       900
     gaagcggaag agatcttaga tgttgaatac gaaaacaccc cgcttgagat agggtttaac       960
     gtcagctatc tgctcgatgt cctcaacaac ttaccttctg atgatgttcg tatcacgctt      1020
     atcgatggta attcgagtgc cctgatagag aaccatatag aagaaaattc tatgtacgtg      1080
     gttatgccga tgagactcta g                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page