(data stored in ACNUC7421 zone)

EMBL: CP000821.PE70

CP000821.PE70        Location/Qualifiers
FT   CDS_pept        79958..80704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0070"
FT                   /product="SAF domain"
FT                   /note="KEGG: shw:Sputw3181_0470 SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34683"
FT                   /db_xref="GOA:A8FPB0"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB0"
FT                   /protein_id="ABV34683.1"
FT                   /translation="MGYVFIVRWRGIAASCFLMLLSCLLPLRAGAEESLDVKLQIENQL
FT                   TRLLSQEIAQWQRQAGLKSVEHNIEVRVPSGAAKLKLCPEPLLIDTGSGLVFGNVQRKV
FT                   LCASQAWSLFVRAKVKVTARLPVANRAMKRGEFIGAQDIEWHPIVLGASDRDLLTKTDD
FT                   IIGRQVNRKLRRHRAIQLHHLNAPQWVNIGDRVIIEARSQGFYANMAGEALESGGEGEA
FT                   IRVKNLSSGKVITAFPTAKGRVTTVF"
     atgggttacg tgtttattgt gaggtggaga ggaatagccg cttcctgttt tctgatgctt        60
     ctttcctgtt tacttccgct tagggctggt gcggaagaat cgctcgatgt aaagctgcag       120
     atagaaaacc aactgacgcg gctgctgagt caagagatcg cccaatggca gcgacaagcg       180
     ggtctgaaat cggtagagca taatattgag gtgagggtgc cctcgggggc cgccaagctc       240
     aagctttgtc ccgagccatt gctgatagat acggggagcg gactggtatt tggcaatgtg       300
     caacgtaagg ttttatgtgc ttcccaagcc tggtccctgt ttgtgagggc taaggtaaaa       360
     gtgacggcca ggctacctgt agcgaacaga gccatgaagc gaggcgagtt tatcggagca       420
     caagatatcg aatggcaccc gatagtctta ggggcttcag acagggactt gctcaccaaa       480
     accgatgata ttatcggtcg ccaggtgaac cgaaaattac gccgacacag ggcaattcag       540
     ttgcatcatc tgaacgcacc tcaatgggta aatattggtg atagggtgat catagaggcc       600
     cgcagtcagg gcttttacgc caatatggcg ggggaggctc tcgagtctgg cggcgagggg       660
     gaggctatcc gggttaaaaa tttgagttcg ggtaaggtga tcaccgcatt tccgacggca       720
     aaggggcgag tcacgacagt attttaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page