(data stored in ACNUC7421 zone)

EMBL: CP000821.PE71

CP000821.PE71        Location/Qualifiers
FT   CDS_pept        80780..81064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34684"
FT                   /db_xref="GOA:A8FPB1"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB1"
FT                   /protein_id="ABV34684.1"
FT                   /translation="MEINKVNSAISAEISTKKESVTLPELTDKKPVSQGSTPKAVSDDW
FT                   HLLARSQPQLQQLEDLDRTKMAEIRQSLRDGSFELNITAISEAMLQQHG"
     atggaaatca ataaagttaa cagtgcgatt agtgctgaaa tcagtactaa aaaggagtcg        60
     gtgacactcc ctgaacttac ggacaagaag cctgtgtctc aaggctcaac tccaaaagcg       120
     gtcagcgatg attggcacct gcttgctcgt tctcagccac agctacagca actcgaagat       180
     ctggatagaa cgaaaatggc tgaaattcgt cagtctctga gggatggaag ctttgaactt       240
     aatatcacgg ctatctcaga agccatgctg caacagcacg gttaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page