(data stored in ACNUC7421 zone)

EMBL: CP000821.PE72

CP000821.PE72        Location/Qualifiers
FT   CDS_pept        81067..81504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34685"
FT                   /db_xref="GOA:A8FPB2"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB2"
FT                   /protein_id="ABV34685.1"
FT                   /translation="MSNKREIVQSIIRGIRQDIEGYKQLKSMLKRQRDLMQRRDNHGLK
FT                   YHNGHQTTLCEHLQQRAKLRSEGLISLGFAGDASGMAQLIAKLPAQASTQMKLLWENLL
FT                   ILVKESQRVNEANGKLLVGQQEVITNLLNRDVPQNIDYGAP"
     atgtcgaata aaagagagat tgttcaatcg attattcgtg gtattcgtca ggatatcgaa        60
     ggttataagc aacttaaaag catgttgaaa cgtcaaagag acttgatgca acgacgcgat       120
     aatcacggac ttaagtatca caatggccac caaacgacgc tgtgtgaaca tcttcagcag       180
     cgagctaagc ttcgaagtga agggcttatc agcttagggt ttgcggggga tgccagtggt       240
     atggcacaac ttatcgccaa gctaccggct caagcatcga ctcagatgaa gctgttatgg       300
     gaaaacctgt tgatcttggt caaagagagt cagcgggtga atgaagccaa tggtaagctg       360
     ttagtcggtc aacaagaggt gataactaac ttattgaatc gagatgttcc gcaaaatata       420
     gactatggtg cgccgtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page