(data stored in ACNUC7421 zone)

EMBL: CP000821.PE73

CP000821.PE73        Location/Qualifiers
FT   CDS_pept        complement(81517..81951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34686"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB3"
FT                   /protein_id="ABV34686.1"
FT                   /translation="MKQLLRLCQQEEKKLSQLGRQRGEAQQRIEAITQQQHNLNRMLHE
FT                   YQQHTPKIANSLLLQNSTNLQLALRPMQARLTRQEILLQQEHRRVDGLWRQQLGRQQGI
FT                   KWLYQKRKQDKIELNNRQEQKQLDDLASRARTNRSQSDES"
     ttgaaacagc tactgagact gtgtcagcaa gaagagaaga aactgagcca actcggcaga        60
     cagagggggg aggcgcaaca gcgcatcgag gctatcactc agcagcagca taacctgaac       120
     cggatgctcc atgagtatca acaacacaca cctaaaatag ccaactctct gctactgcaa       180
     aacagcacca atctccagtt agctttgaga ccgatgcaag cccggttaac gaggcaagag       240
     atattactgc agcaggaaca tcggcgagtc gatggattat ggcgccagca acttggccgt       300
     caacagggga taaaatggct ctaccaaaaa cgaaaacagg acaaaataga gctcaataat       360
     cggcaggaac agaaacagct cgatgatctt gcctcaagag ccaggacaaa cagatctcaa       420
     tctgatgagt cttag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page