(data stored in ACNUC7421 zone)

EMBL: CP000821.PE75

CP000821.PE75        Location/Qualifiers
FT   CDS_pept        complement(83299..84057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0075"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="KEGG: sbl:Sbal_3977 flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34688"
FT                   /db_xref="GOA:A8FPB5"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB5"
FT                   /protein_id="ABV34688.1"
FT                   /translation="MTFPVDKMDPKWRLKKELARRHRFAPLVQQPPMEGEAGTGWQDYQ
FT                   EAFDKGYEEGVAKGHLEGFESGSEEGRRSGHASGFNQGRIEGNLKGKEAIDEQLNQLIA
FT                   PLGALKSILEEGHTHQVSQQQTMLLDLIRRVAQQVIRCELTLQPQQILSLVEETLTALP
FT                   DTRSEIKIHLEPNAVNKLKELASDKIQDWTLVADPSISAGGCRIVSDKSDADASVETRL
FT                   NVCMDQVSAKLKEPETSNTNSEAELPIDVA"
     atgacattcc cggtagataa aatggatcct aagtggcgcc tgaagaaaga gctggcacgc        60
     cgtcatcgat ttgccccctt agttcagcag cccccgatgg aaggcgaggc cggtaccggc       120
     tggcaagact atcaggaagc gttcgataaa ggttatgaag agggagtcgc caaggggcat       180
     ttggagggct tcgagtcggg ctcagaagag ggacgtcgct caggccatgc aagcggattc       240
     aatcaggggc gaatagaggg aaacctaaag ggtaaggaag ctatcgatga gcaactcaat       300
     cagcttatcg ctcccctggg tgcacttaaa tcaattctgg aggagggcca cactcatcag       360
     gtctcacaac aacagaccat gttactcgac ctgattagac gcgtcgccca acaagtgatc       420
     cgctgtgaac tcaccctgca gccacaacag atcttatctc tggtcgagga gacattaacg       480
     gcccttccgg atacgcgctc cgagataaaa attcacctgg aacccaatgc cgttaataag       540
     ctcaaagagc tggcatcaga taagatacaa gactggacct tagtcgccga tccgagcata       600
     tctgccggcg gctgccggat agtgagcgac aaatctgatg ctgacgcctc ggttgaaacc       660
     cggctgaatg tttgtatgga tcaggtctcg gctaagctca aagagccgga aacaagcaac       720
     acaaacagcg aagctgagct ccctatcgat gttgcataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page