(data stored in ACNUC7421 zone)

EMBL: CP000821.PE76

CP000821.PE76        Location/Qualifiers
FT   CDS_pept        complement(84057..85070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0076"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="KEGG: sbl:Sbal_3978 flagellar motor switch protein
FT                   FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34689"
FT                   /db_xref="GOA:A8FPB6"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB6"
FT                   /protein_id="ABV34689.1"
FT                   /translation="MNKSELGIKMDNLEQAAMLLLSMGEKGAAQVMAHLDRNDVQHLSH
FT                   KMARLSSITQQEAEAVLGRFFMRYQEQSGIARASRSYLQKTLDLALGDRVAKSLIDSIY
FT                   GDEIKTLVKRLEWVDPQLLAREITNEHSQLQAVLLGLLPPESAAQVLLSLPAEGQDEVL
FT                   VRIAQLGELDRDVVDELRQLVERCMLIAMEKSHTQVAGIRQVADILNRFEGDREQLMDM
FT                   IKLHDTKLASDVADNMFDFIILGRQKPETLQEIMAIVPPEMLALALKGIDSELKSTLLL
FT                   ALPKRMSSAIETQVEAIGAVPLSQATSARKEIMELAKQMMDDGEIELQLFEEQVVE"
     gtgaataaga gtgaacttgg aataaagatg gataacctgg agcaagcagc catgttgttg        60
     cttagcatgg gagagaaggg agccgctcag gtgatggcac acctggacag aaatgatgtt       120
     caacacctga gccacaagat ggcccgctta tcgagcatta cccaacagga agcagaagcg       180
     gtactcggac gtttctttat gcgctaccag gagcaatccg gtatcgccag agcatctcgc       240
     tcatacctgc agaagacttt agatcttgcg ctgggcgatc gtgtcgcaaa aagcctcata       300
     gacagtattt acggtgacga aattaaaacc ttagtcaaac gtttagagtg ggtagacccg       360
     cagctgttag ccagagagat caccaatgag cacagtcagc tccaagccgt actgcttggc       420
     ctgctcccac cggagagtgc agctcaagtg ctccttagcc ttccagcaga aggtcaggat       480
     gaggtgttgg tccgtatcgc tcaactcggt gaactcgaca gagatgtcgt cgatgagcta       540
     aggcaactgg tcgagcgctg catgttaatc gccatggaga agagccatac tcaagtcgcc       600
     ggcattcgtc aggttgcaga tattctcaac cgctttgagg gcgacagaga gcaactgatg       660
     gatatgataa aactccatga tacaaaattg gccagtgatg tcgccgacaa catgtttgat       720
     tttattattc ttggaagaca gaagcctgaa actctgcagg agatcatggc aatcgtccct       780
     ccagagatgt tggcattagc actgaagggg atcgattcag aactcaaatc caccctactc       840
     cttgccctgc caaaacgtat gtcatcggca attgagacgc aagttgaagc catcggcgcc       900
     gttcccctaa gtcaggcgac cagtgccaga aaggagatca tggagttagc caagcagatg       960
     atggatgacg gtgagattga gctacaacta tttgaagagc aggtggtcga ataa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page